KEGG   Penicillium rubens: Pc12g07810Help
Entry
Pc12g07810        CDS       T01091                                 

Definition
(RefSeq) Pc12g07810
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pcs  Penicillium rubens
Pathway
pcs00052  Galactose metabolism
pcs00500  Starch and sucrose metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Pc12g07810
   00500 Starch and sucrose metabolism
    Pc12g07810
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Pc12g07810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 8311247
NCBI-ProteinID: XP_002557615
UniProt: B6GXD3
LinkDB All DBs
AA seq 983 aa AA seqDB search
MAFLTKVLLASVGLLPAVHAASSTSSAANAQYTLPFDSMEGVTMIPNVENPKAVDAQAVC
PGYKVSNVKHSLRGLTATLSMAGEPCNAYGTDIESLSLTVDYQAKDRLNVQIIPAHIDAT
NASWYLVDEDVVPRSQASNGSVNASDLTFSWSNSPSFNFEVTRKATGDVLFSTKDTVLVY
ENQFIEFETSLPEGYNLYGLGDRVQQFRIKENLTLTTWAADAGNVIDENLYGTHPFYLDT
RYYAIDKKSGARRMVKPGEGDQIQDYAAYSHGVFLRNAHGQEVITKPDSLVWRTLGGSVD
LTFYSGPSQEEVTKNYQISTIGLPAMQQYSALGYHQARWGYANWSVMADVVATFEKFEIP
LEYMWADIDYMNQYRNFENDLNTFPYEEGQEFLEKLHQSGRHFVPIIDSALYIPNPQNAS
DSYPTFDRGVAADAFIKNPDGSLYIGAVWPGYTVFPDWNSPRASEYWVNELELWRQKVPY
DGIWIDMSEVASFCVGSCGTNMLHLNPIHPPFLLPGEPGNVDYGYPEGFAVTNTTEARAI
AAAERRQVAAAKEESDGSQPSSVSILHPTVTPGVRNINYPPYVISNVQTGHDLAAKAVSP
NATHSDGAVEYDVHNLWGHQILKATYDGMLRMWPGKRPFLLGRSTFAGSGKWAAHWGGDN
ESRFASMYFTIPQALSFSLFGMPMFGPDTCGFSGNADLELCSRWMQLSAFFPFYRNHNVL
ASIPQEPYRWAAVIEASKKAMAIRYAILPYLYTLFHLAHTTGSTVMRALAWEFPDPTLAS
VDTQFLLGPFLMVVPVLEPLVDSVKGVFPGVGQGEVWYDWYTQTAVDAQPGVNTTIAAPL
GHIPVFMRGGSILPMQEPALTTQAARKTPWALLAALDKNGTAYGQLYLDDGESLEPTETL
NVKFKAGKTRLTATATGTWVESNPLANVTVMGVSSVPSNVTFNNQPVQSSSVQYDATAQV
LFVGGLQNMTAHGAWAKPWTLRW
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctcacgaaggttttgctggccagtgtcgggctgcttccggcagttcatgca
gcttcgagcacttcttccgcggcgaatgctcagtacacgcttccctttgactcaatggaa
ggtgtcaccatgattcctaacgtggagaaccccaaagcagtcgatgcgcaagctgtctgc
ccgggttacaaggtctcaaacgtgaagcattcattacggggcttgacagctactctgtcg
atggccggagaaccatgtaacgcctacggcaccgacatcgagtctttgtcccttacagtg
gattaccaggcgaaggatcggttgaacgtccagatcatcccggcccacattgatgcaacc
aatgcatcctggtatctggtcgatgaagatgtcgttccgaggtcgcaggcctccaacgga
tccgtcaacgccagtgacctaactttctcgtggtccaacagcccatctttcaactttgaa
gtgaccagaaaggcaactggcgatgttctttttagtacgaaggacaccgttctagtttac
gagaaccagttcatcgagttcgaaacatccctgccggagggctacaacctctacgggcta
ggagatcgtgttcagcagttccggattaaggagaaccttaccttgaccacctgggcagct
gatgctggaaatgtcatcgacgagaacttgtacggtactcatccattttatttggatacc
cgctactacgctatcgacaagaagagcggcgctcgccgtatggtcaagcctggcgaaggc
gatcagatccaggattatgctgcatactcccatggtgtgtttctgaggaacgcccatgga
caggaagtcatcacaaagccggatagcttggtatggcgtaccctgggtggaagcgttgac
ctcacattctactccggtccttcccaggaggaggtcaccaagaactaccagatcagcacg
atcgggcttcctgcaatgcaacaatacagcgcccttggctaccaccaggcccgatgggga
tatgctaactggtctgtaatggctgatgtggttgctactttcgagaagtttgagattccc
ctggaatacatgtgggccgacattgactacatgaatcagtaccgtaatttcgagaacgat
ctcaacactttcccatacgaggagggccaggaatttctcgagaagctgcaccagagtgga
cgtcactttgttccgatcatcgactctgccctctatattcccaaccctcaaaatgcatcg
gactcgtatcctaccttcgatcgaggtgtcgcagcagatgcttttatcaagaaccccgat
ggcagcctttatattggtgctgtgtggcctggctacacagtcttccctgattggaactct
cccagggcttctgagtactgggtcaacgagcttgaactgtggcgccagaaggttccatac
gacggtatctggattgacatgagcgaggttgcctcgttctgtgttggcagctgtggaacc
aacatgctgcacctgaaccccatccatccgccattccttcttccaggagaacctggaaat
gtggactatggctatccggaaggtttcgcggtcactaacaccaccgaggctcgggctatt
gccgccgctgaacgccgtcaggttgctgccgccaaggaagaatccgatggcagccagccc
tcttcagtctcaatcctacatccaaccgtcacccctggtgtccgcaatattaactaccct
ccctatgtgattagcaatgtgcaaactggtcatgatcttgctgccaaggcagtttctcct
aatgccacccactcggatggtgctgtggaatacgacgtccacaatctctggggtcaccag
atcctcaaggccacctacgacggcatgctcaggatgtggccaggaaagcgtcctttcctc
cttggccgttccacttttgctggctcagggaaatgggcagcccactggggtggtgacaat
gagtcccgctttgcatcgatgtactttacaatcccccaggccctctcattctcactcttc
ggaatgcctatgttcggccccgatacttgtggtttctcgggtaacgcggatttggaactc
tgtagccgttggatgcagctctcggctttcttccccttttaccggaatcacaatgttctg
gcttctattcctcaggagccataccgctgggcggctgtaattgaggcttcgaagaaggca
atggctatccgctatgctattttgccatacttatacaccttgttccaccttgcgcacact
accggttcgacggtgatgcgggctcttgcatgggagttccctgaccctacacttgctagc
gtcgacacacagttcctcctgggtccatttcttatggttgtccctgtccttgaaccgttg
gttgattccgtgaagggagtgttccctggtgtcggtcagggtgaagtctggtacgattgg
tacacacagacagccgtcgatgctcagcctggtgtcaacactacaatcgcagcgccctta
ggccacatccctgtctttatgcgaggaggatctatcttgccaatgcaagaacctgccttg
accactcaggctgcgcgcaagacaccgtgggccctcctggctgctctagacaagaatggt
actgcatacggccaactctacctagatgatggagaaagcctcgaacccaccgagactctg
aatgtcaagttcaaggccggcaaaactcgcctcactgccacggcaaccggaacttgggtt
gagtcgaacccgctcgctaacgtgacggtgatgggtgtgtcgagtgtgccttcgaacgtg
acttttaacaaccagccggtccagtcctcgtcggttcagtatgatgccaccgcccaggtc
ctgtttgtcggcggcttgcagaatatgactgcacatggtgcgtgggcgaagccctggact
ctgcggtggtaa

DBGET integrated database retrieval system