KEGG   Penicillium rubens: Pc13g09370Help
Entry
Pc13g09370        CDS       T01091                                 

Definition
(RefSeq) Pc13g09370
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pcs  Penicillium rubens
Pathway
pcs03030  DNA replication
pcs03410  Base excision repair
pcs03420  Nucleotide excision repair
pcs03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pc13g09370
   03410 Base excision repair
    Pc13g09370
   03420 Nucleotide excision repair
    Pc13g09370
   03430 Mismatch repair
    Pc13g09370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcs03032]
    Pc13g09370
   03400 DNA repair and recombination proteins [BR:pcs03400]
    Pc13g09370
Enzymes [BR:pcs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pc13g09370
    6.5.1.6  DNA ligase (ATP or NAD+)
     Pc13g09370
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Pc13g09370
DNA replication proteins [BR:pcs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Pc13g09370
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Pc13g09370
DNA repair and recombination proteins [BR:pcs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Pc13g09370
   NER (nucleotide excision repair)
    Other NER factors
     Pc13g09370
   MMR (mismatch exicision repair)
    Other MMR factors
     Pc13g09370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 8316064
NCBI-ProteinID: XP_002559361
UniProt: B6H3T7
LinkDB All DBs
AA seq 833 aa AA seqDB search
MPSPAKKRKRNGDSSQPTRSIKSFFKEQTTEQTNSIVPDVTEQTLSDEALARKLQAEWTE
QGNNNTPTEDTKGALQVNTVPSTLDSPVPPPVAPVIPKKSTLSLQSSAGTEDTISLAISL
DQSPQTFDASQYAAEMRSHWATEGGDASYALLTRAFVLANATTSRIRIVDTLVNFLRVLI
EGDPSSVLPAVWLATNSISPPYDELELGLGGSSISKALKKIYGLNNQGLKTLYDKHGDAG
DVAFEAKKRQSFTLVKPKPLRIKGVYQSLKKIATSKGPGSQETKQRIVEKLLQDARGAEE
SRYIVRTLVQNLRIGAVKTTMLIALARAVLYSKPVGADFEVRPPNQLARLKKDELAEIYS
SAEEIVKASYARHPNYNDLVPCLLEIGPTEELLIRCGLSMHIPLRPMLGSITRDLSEMLT
KLQGRDFSCEYKYDGQRAQVHCDEQGTVSIFSRHLELMTEKYPDLVSLVPQIRGEGVSSF
ILEGEVVAVDRETGDLKPFQVLTNRAKKNVEIGDIKVNVCLFAFDLMYLNGEPLLDRPFR
ERRELLRSLFVEIPRHFGWVKSMDATSADSESVLEFFKSAIDVKCEGIMVKLLDNKPSAN
TQQVNNKLSDEIAAITTEQPNQAIYDPITNPNPKAKPTRRKPLLSTYEPDKRLESWLKVK
KDYSTSSETLDLIPIAGWHGQGRKAKWWSPILMAVRNPETGSLEAVTKCMSGFTDKFYQS
NKEKYAQGSTNVISRPSYIEYPGEPDVWFDPSEVWEMAFADITLSPTYPAAIGLVSDERG
LSLRFPRFIKVREDKSIDEATSSDYLALLWRKQMERTGDVAEVGDVSLEEGME
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtccagccaagaagcggaaaagaaatggagattcgtcgcagccgacgcgcagt
atcaagtcgttcttcaaagagcagaccaccgaacaaaccaattcgattgtccccgatgtc
accgagcagactctctccgatgaagctcttgcgcgcaagctacaggctgagtggactgag
cagggaaataacaacactcctaccgaagatacaaaaggagctctgcaggtcaatacagtt
ccatctacattagactcgcccgttccaccgccggtagcgccggtgataccaaagaagagc
actctctcactacaatcatcagctggcacggaggatacaatatcccttgctatttctctt
gatcaaagcccccaaacgtttgatgccagccaatatgcagcagaaatgcggtcgcattgg
gcaaccgaaggcggagatgcttcttacgctttattaacgagagcatttgtcctggcgaat
gcgacgaccagtcgaataaggattgtcgatacgctggtcaactttcttcgggttctgatt
gaaggggacccatccagcgtcttgcctgctgtgtggctagcgaccaattccatatcacct
ccatatgatgaattagagctagggctgggaggctcttccatctctaaggcactaaaaaag
atatacggcctcaataaccaggggctgaagaccctgtatgataaacacggcgatgcagga
gatgttgcattcgaggccaaaaaaagacaatcattcactttggtgaagccgaagccgtta
agaatcaagggagtataccagtcactgaagaaaatcgccaccagcaaaggacctggtagt
caagaaaccaagcaaaggatcgttgagaagcttctacaggatgcgcgcggcgccgaggaa
agtcgatacattgtccggacgttggtccagaatctgcgaattggcgcagtcaagactacg
atgctgattgctctcgcacgagctgtgttatattccaagccggtcggagcagatttcgaa
gttcgtccgccgaatcaacttgcacgtttgaagaaggacgagcttgcggaaatatacagc
agcgcggaagaaatcgtcaaagcgtcatatgctagacatcccaattacaatgatttggtg
ccctgcttattggagatcgggcctacagaggagcttttgatcagatgcggcctatccatg
cacattccactaaggccgatgctgggcagtatcacacgcgatctgtcggagatgttgacg
aagctccaaggccgggacttcagctgcgaatacaagtacgacgggcaacgcgcgcaggta
cactgcgacgagcaagggacagtttctatcttctcgcgccatcttgaactcatgacggag
aaatatccagatcttgtctcactggtcccgcaaatacggggggaaggcgtgtccagcttt
atcctagagggagaagtagttgccgtggaccgtgagactggcgatcttaagccattccag
gttttgaccaatcgtgcaaagaaaaacgttgaaatcggggacatcaaggtcaatgtctgt
cttttcgcattcgacctcatgtatctcaacggcgagcctttgctagatcgcccctttcga
gaacgtcgcgaactacttcgcagtctctttgtggagattccaagacacttcggctgggtg
aagagcatggatgcgacatcggcggattccgagtctgtccttgagttcttcaaatctgcc
atcgatgtcaagtgcgagggtattatggtcaaactcctcgataacaagcccagtgcgaac
acccaacaagtcaacaacaaactctccgacgaaatagctgccataaccaccgagcaacca
aaccaagcaatatacgacccaataaccaaccccaaccccaaagcaaaacccacccgacgc
aagcccctcctctcaacctacgaaccggacaaacgactcgaatcctggctcaaagttaaa
aaagactacagcacatcctccgaaaccctcgacctaatcccgatagccgggtggcacggc
caaggacgtaaggcgaaatggtggtccccgatcctaatggcagtacgcaacccggaaacg
ggatccctggaagccgtaacaaaatgcatgtccgggttcacggacaaattctaccaaagc
aataaagaaaaatacgcgcagggtagcacaaacgtaatctcgcgccccagctacatcgaa
taccccggcgaaccagacgtgtggtttgacccgagcgaggtgtgggaaatggctttcgcg
gatatcacgctcagccctacgtacccggctgctattgggctggttagtgatgagcgtggg
ttaagtctgcgctttccacgatttattaaggttcgtgaggataagtcgattgatgaggct
acctcgtcggattacctagcattgctgtggcgcaagcagatggagcggactggggatgtt
gcggaggttggtgatgtcagtctggaggagggaatggagtag

DBGET integrated database retrieval system