KEGG   Penicillium rubens: Pc16g00620Help
Entry
Pc16g00620        CDS       T01091                                 

Definition
(RefSeq) Pc16g00620
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pcs  Penicillium rubens
Pathway
pcs00500  Starch and sucrose metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc16g00620
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Pc16g00620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 Gag_spuma
Motif
Other DBs
NCBI-GeneID: 8317640
NCBI-ProteinID: XP_002560481
UniProt: B6H6W4
LinkDB All DBs
AA seq 631 aa AA seqDB search
MAPRFWTALWALTLGHAVVATPQILAPRATGSLDTWLASETVVARQGILDNIGSAGAHAA
NAKPGVVLASPSTSDPDYYYTWTRDSALVFKNLVDMFRSGDSALLEVIEEYISSQAYIQT
VSNPSGGLSGGGGLGEPKFNADETAFTGSWGRPQRDGPALRATALISFGQWLIDNGYTTY
ATDIVWPVVRNDLSYVSQYWNQTGFDLWEEVSGSSFFTVAAQHRALVEGSTFASQVGSSC
LYCDSQAPQVLCFLQSFWTGSYILANFGGGRSGKDANTLLGSIHTFDPEAGCDDTTFQPC
SARALANHKVVTDSFRSIYSVNSGIAAGKAVSVGRYPEDSYYNGNPWYLCTLAAAEQLYD
AIYTWNRIGSLTITSVSLSFFKDLYSSAATGTYSSSSDTYSSIVAAVKEYADGYVSIVEK
YAASSGSLSEQFSKSDGSQLSARDLTWSYAALLTANERRNAIVPAPWGETSASSVPGQCQ
YTSAIGTYSSATNTAWPTTLTSGSGSVTTTKTTTTTSKPTTTSCTTPTTVAVTFNVIATT
EYGQNIKLAGSISQLGSWSPSSAVALSASKYTTSNHLWFVTVTLPVGTSFSYKYIQVASD
GTIKWESDPNQSYTVPATCGTTAVTVSDTWR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcgtttttggactgcgctttgggcgcttacgcttggccatgccgttgtggcc
acgccacagatattggctcctcgtgcgactggcagtttggatacctggttggcgtctgag
actgtggtggcaagacagggtatcttggacaacatcggatcggctggtgcccatgctgcc
aatgcaaagccgggcgttgtactcgccagcccgagtacctccgaccctgattattattat
acttggactcgtgactcggccctagtgttcaaaaatctggtcgacatgttcaggagcggc
gacagcgctttgttggaggttatcgaagaatacatcagctcgcaggcctatatccagacg
gtgtcaaatccatctggaggtctttccggcggcggtggattgggagagcccaagttcaac
gccgatgagacagctttcactggctcttggggacgccctcagcgtgatggaccagccttg
cgagccactgccttgatctcatttggccaatggcttattgacaatgggtacaccacctac
gcgaccgacattgtctggcctgtcgtgcgcaatgatctctcctatgtttcccagtactgg
aatcagactggatttgatctctgggaagaagtttctggctcatcattcttcaccgtcgcg
gctcagcaccgcgctttggtggagggaagcacattcgcaagtcaggtcggttcttcatgt
ttgtactgtgactcccaggctccgcaggttctgtgcttcctacagtccttctggactgga
tcttacattctggccaactttggtggtggccgctctgggaaggacgccaatacactgctc
ggcagcattcacacattcgacccagaggcaggatgcgatgacacgacgttccagccttgc
tcagcacgagcactcgcaaaccacaaagttgtaactgactcgttccgatcgatctactct
gtcaactctggtatcgctgcgggtaaggctgtttctgttggtcgatacccagaggactca
tactacaatggtaacccttggtacctgtgcactttggctgcagctgagcagttgtatgat
gctatctacacatggaaccgtattggttctttgaccattacctctgtctctttgagcttc
ttcaaagacctatacagctctgctgcgaccggcacctactcctcatccagtgatacatac
tcctcgatcgtggccgctgtaaaggaatatgcagatggatatgttagcatcgtggaaaaa
tacgctgcatcaagtggttccttgtccgagcaattctccaagtcagatggctcgcagctg
tcagctcgtgacctgacttggtcctacgcagccctacttactgccaatgagcgtcgaaac
gccatagtccctgcaccatggggggagacatctgctagcagtgtccctgggcagtgtcaa
tatacttcggccattggtacttacagcagcgcaacaaacaccgcctggcctaccactttg
actagtggatcgggcagtgtaactaccaccaagacgactaccactacctcgaagccgaca
acaacatcatgcactactccgaccactgttgcagtgacgttcaatgtgattgctactact
gaatatggccagaacatcaaactcgctggatctatctctcaacttggctcatggtcgcca
agcagtgctgtcgcattgagcgcttccaaatacaccacgagcaaccacctgtggtttgtg
accgtgacacttccagtaggcactagcttcagctacaagtacatccaggtggcgagcgat
ggcactatcaagtgggaaagtgacccaaaccagtcgtataccgttcccgccacgtgtggt
actactgctgtcaccgtcagtgatacatggaggtag

DBGET integrated database retrieval system