KEGG   Penicillium rubens: Pc20g01100Help
Entry
Pc20g01100        CDS       T01091                                 

Definition
(RefSeq) Pc20g01100
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pcs  Penicillium rubens
Pathway
pcs00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Pc20g01100
Enzymes [BR:pcs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Pc20g01100
Chromosome and associated proteins [BR:pcs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Pc20g01100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET WW
Motif
Other DBs
NCBI-GeneID: 8312247
NCBI-ProteinID: XP_002562671
UniProt: B6HGS4
LinkDB All DBs
AA seq 688 aa AA seqDB search
MSAHDYADSEEPAKMERDSPVNGNHLKNGDSRTSSRSPLPPKKESSPNSDAPDPMKENIG
EIVLKQEPGQPPKLSRSSSQKVASRPPPLYTHLPDSTQDALATFEQIPGCIYANKYMGYT
EHAMECDCAEEWDPKIGRNIACGEDSDCINRATKIECAGECGCGPDCQNQRFQKRQFAPV
SVIKTEKKGFGLRAEKNLDPGELIYEYVGEVVGEQQFRKRMRQYDEEGIKHFYFMSLNKG
EFVDATKRGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAERAVQAGEELVFNYNVDRYG
ADPQPCYCGEPMCTGFIGGRTQTERATKLSNATIEALGIDEADGWDTVVAKRPKKKKMEE
DDEEYVDSVQPKSLDEDGVTKVMAALVQCQEKWIAVKLLGRIQRCDDERVRNRVVRMHGY
QILNSQLAQWKEDQNVVLQILNILDGFPRLTRNKIQDSKIETNIRPLTTCDDERVPKKAV
ALLESWAGLEVAYRIPRMKRGKDAKQAINQFERRETGQEQRQRSLTRSPSPVYDAPRGPA
QQRRDRGPQRSRQPNRRGPRPLPEGWYTAEAEGRVYYYSASGKTTWERPTLPATPATPAP
GQPAKNQQNLALQSIIDGIMNTQEDTPSENRTATPVTPQPSADQPERRHKDGEKWRKLPL
EKQKRIYENTVTFPAYQARGGSVQTQDP
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccatgactacgcggactctgaagagcctgccaaaatggagcgggactctccg
gtaaacggcaatcatttgaaaaacggcgattcgcgtacctcctctcgatctcctcttcct
ccgaaaaaggagtcctcccccaactccgatgcacccgacccaatgaaggaaaatatcggc
gagatcgtccttaagcaggaaccgggccaaccgcccaagctgtcacgcagctcgtcgcag
aaggtcgcgtcgcgacctccgccgctgtacacgcacctgccggatagcacccaggatgcg
ctcgccacctttgaacagatccccggctgtatctacgccaacaaatacatgggatacacc
gaacatgccatggaatgtgattgcgctgaagagtgggacccgaagattggtcgaaatatc
gcatgtggtgaggattcagactgtatcaaccgcgcgaccaagatcgagtgtgcgggcgaa
tgcggctgtggtcccgactgtcaaaaccagcggtttcaaaaaagacagtttgccccggtg
tccgttatcaaaacagaaaaaaagggattcggattgcgcgcggaaaagaatctcgacccg
ggcgaattgatttacgaatatgttggtgaggtcgtgggagagcagcaattccgaaagcgc
atgagacagtatgatgaggagggcatcaagcacttctactttatgtccttgaacaagggc
gagtttgtcgatgcgaccaagcgaggcaacctgggacgattctgcaatcactcgtgcaat
cccaactgctatgttgacaaatgggtcgtgggcgagaagctacgtatgggaattttcgct
gaacgcgctgttcaggccggcgaggagctggttttcaactacaatgttgaccgatacggt
gccgacccccagccctgctattgtggggagcccatgtgcacaggattcatcggcggacgc
actcagacagagcgtgcgaccaagctatcgaatgcaactatcgaggctctcggtattgat
gaggccgatggctgggatactgtggtggcgaagcgcccaaagaagaagaagatggaagag
gacgacgaggagtatgtggacagcgtgcagcccaagtcgctggatgaggatggtgtgacc
aaggtcatggcggctcttgtgcagtgccaggagaagtggatcgcggtcaaactgctaggt
cgtatccagcgctgtgacgatgaacgcgttcgcaatcgcgtggtcaggatgcacggatac
cagatcctgaactcccagctcgctcaatggaaggaagaccagaacgtggttttgcagatc
ctgaacatcctcgacggcttcccgcgactcacccggaacaagatccaggactccaagatt
gagacgaatattcggccgttgacgacctgtgatgatgagcgcgtcccgaagaaagcagtc
gcccttcttgagagctgggctggtctggaagtcgcataccgaatcccgcgcatgaaacgc
ggcaaggacgcgaagcaggcaatcaaccagttcgagcgccgcgaaactggacaggagcag
cgccagcgatctctcacccgctctccatctcctgtgtacgatgctcctcgtgggccggca
cagcaacgaagagaccgaggtcctcagcggtccagacaacccaaccgtcgtggtccccgg
cccttgcctgagggatggtatactgcagaggcagagggccgcgtttactactactccgca
tcaggcaaaacaacatgggaacggccaactttgcctgctacccctgctactcctgcgccg
ggtcaacccgccaaaaaccaacaaaatttggcattgcagagtatcattgacgggatcatg
aacacccaggaagacacaccttccgagaaccgaactgctacacccgtgactcctcagcct
tccgccgatcaaccggaaagaagacacaaagatggagagaaatggaggaagcttccattg
gagaaacagaagagaatatacgagaacacggtgacttttcccgcttatcaagcccgtggt
ggatcagtacaaacacaagatccctga

DBGET integrated database retrieval system