KEGG   Penicillium rubens: Pc20g03610Help
Entry
Pc20g03610        CDS       T01091                                 

Definition
(RefSeq) Pc20g03610
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pcs  Penicillium rubens
Pathway
pcs00020  Citrate cycle (TCA cycle)
pcs00480  Glutathione metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01200  Carbon metabolism
pcs01210  2-Oxocarboxylic acid metabolism
pcs01230  Biosynthesis of amino acids
pcs04146  Peroxisome
Module
pcs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pc20g03610
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pc20g03610
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Pc20g03610
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Pc20g03610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 8309966
NCBI-ProteinID: XP_002562912
UniProt: B6HGF9
LinkDB All DBs
AA seq 486 aa AA seqDB search
MNALRSSSAVARRSLATPPAPLSSTSRLISSSSFTSSLSKRSISSTSLSQRTNRVAASSR
WSGSIPSSITQIRTMASETKIKVKNPVVELDGDEMTRIIWQEIREKLILPYLDIDLKYYD
LGIEYRDETNDQVTIDAAEAIKKYGVGVKCATITPDEARVEEFKLKKMWLSPNGTIRNIL
GGTVFREPIVIPRIPRLVPGWTKPIIIGRHAFGDQYRAQDRVIPGPGKLELVYTPAGGEP
ERVQVFDFQGGGVTQCQYNTDESIAGFAHSSFKMALMKGLPLYMSTKNTILKKYDGRFKD
IFEEIFQKDYKKDFDAKNIWYEHRLIDDMVAQMIKSEGGFVMALKNYDGDVQSDIVAQGF
GSLGLMTSALATPDGSAYESEAAHGTVTRHYREHQKGNETSTNPIASIFAWTRGLVQRGQ
LDNTPEVVTFAEELERACVDVVNDEAIMTKDLALACGRKDRESWVTTGEYMAAVERRLKA
NLKARL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctccggtccagttccgcagtcgctcgtcgatccctcgcgacccctcctgcc
cctctctcttctacctctcgtcttatttcttcctcttccttcacttcttcactttctaag
agatctatctcctctacctccctctctcaacgaactaatcgagttgctgcttcttcccgc
tggtccggatcgatcccttcgtctatcactcaaatccgcactatggcttccgaaaccaag
atcaaggtcaagaaccctgtggtcgagttggatggtgatgagatgacccgtattatctgg
caagaaatcagagaaaagttgattctgccttatctcgatatcgatctcaagtactacgat
ttgggtattgagtaccgtgatgagaccaatgatcaggtcaccatcgatgccgccgaggct
attaagaagtacggtgttggtgtcaagtgtgccaccatcacccccgatgaggcccgtgtt
gaggagttcaagctgaagaagatgtggctctcccccaacggcaccatccgtaacatcctc
ggcggtaccgtgttccgtgagcccattgtcattccccgcattccccgcctggtccctggc
tggactaagcctattattattggccgccacgccttcggtgaccagtaccgtgcccaggac
cgtgtcattcctggccccggtaagctcgagttggtctacacccctgccggaggtgagccc
gagcgcgttcaggtcttcgatttccagggcggtggtgtcacccagtgccagtacaacacc
gatgagtccatcgctggcttcgcccactcctccttcaagatggccctcatgaagggtctt
cccctctacatgagcaccaagaacactatcctcaagaagtatgatggccgcttcaaggac
atcttcgaggagatcttccagaaggactacaagaaggacttcgatgccaagaacatatgg
tacgagcaccgtctcattgacgatatggttgcccagatgatcaagtccgagggtggcttc
gtcatggctcttaagaactacgacggtgatgtccagtccgacatcgtcgcccagggcttc
ggctctctcggtctgatgacctccgctctggctacccccgacggctctgcctacgagtcc
gaggccgcacacggaaccgtgacccgtcactaccgtgagcaccagaagggcaacgagact
tccaccaaccctattgcctctatcttcgcctggacccgtggtctcgtccagcgtggccag
ctcgacaacacccccgaggttgtcaccttcgctgaggagctcgagcgcgcctgcgttgac
gtcgtcaacgacgaggctatcatgactaaggatctggctctcgcctgtggccgcaaggac
cgtgagtcctgggtcaccactggcgagtacatggctgccgttgagcggaggctgaaggcc
aacctcaaggctcgcctgtag

DBGET integrated database retrieval system