KEGG   Penicillium rubens: Pc20g06030Help
Entry
Pc20g06030        CDS       T01091                                 

Definition
(RefSeq) Pc20g06030
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pcs  Penicillium rubens
Pathway
pcs00020  Citrate cycle (TCA cycle)
pcs00190  Oxidative phosphorylation
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01200  Carbon metabolism
Module
pcs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcs_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pc20g06030
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Pc20g06030
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Pc20g06030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO PAPS_reduct
Motif
Other DBs
NCBI-GeneID: 8310701
NCBI-ProteinID: XP_002563132
UniProt: B6HFS4
LinkDB All DBs
AA seq 647 aa AA seqDB search
MSSMSLRSLAPASKVSRVLRDQRRLFSSSRPAARIWSNQPLRAKESNGYLTDKYPIIDHE
YDALVVGAGGAGLRAAFGLAEAGFKTACVSKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVRELEGYGCPFSRTEDGRIYQRAFGGQSKDYG
KGGQAYRCAAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLMEGGECRGVIAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPAELLHERLPGISETASIFSGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LDVDENGQEKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHRVRDIATPGKP
HKELSSDAGAQSIKDLDFARTADGPKSTFEVRNAMQRTMQSDVSVFRTQESLDEGVDKVN
KVDQLYSQVGTKDRSMIWNSDLVETLELRNLLTCATQTAASAAARKESRGAHAREDYPDR
DDEKWMKHTLSWQKKPHGEVKLGYRAVEANTLDAEECKPVPPFKRTY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagctccatgagcctgcggagcctagctcctgcatccaaggtttcccgtgttttgcgg
gaccagagacgtcttttctcttcttcaaggcccgcagcccggatatggtccaaccagcct
ttgcgcgccaaggagtccaatggctacctgaccgacaagtaccctatcattgatcacgag
tacgatgccctcgttgtcggtgccggtggtgccggtctgcgcgctgctttcggtctggcc
gaggctggattcaagactgcttgtgtctccaagctgttccccacaagaagtcacactgtc
gctgctcagggtggtatcaacgctgcccttggaaacatgcacgaggatgactggagatgg
cacatgtacgataccgtgaagggttctgattggcttggtgaccaagatgccattcactac
atgacccgcgaggctccggccagtgttcgcgagcttgagggttacggttgccccttctcg
cgtaccgaggatggacgtatttaccagcgtgctttcggtggtcagtccaaggattacggc
aagggtggtcaggcttaccgctgcgccgccgccgccgaccgtactggtcacgcccttctg
cacactctctacggacagtcactccgccacaacaccaactacttcatcgaatacttcgcc
ctcgacttgctgatggagggtggtgagtgccgtggtgtcattgcctacaaccaggaggat
ggtactctgcaccgcttcaaggcccaccacactgtccttgccaccggtggttacggacgt
gcctacttctcctgtacctccgcccacacttgcaccggtgacggtatggctatggttgct
cgtgctggtctccctaaccaggatcttgaattcgtccagttccaccctactggtatctac
ggtgccggttgcctgattaccgagggctcccgtggtgagggtggttacctgctcaactcc
gagggtgagcgtttcatggagcgttacgctcctaccgccaaggaccttgcctcccgtgac
gttgtttcccgctccatgactctggagatccgtgagggccgtggtgtcggccctgagaag
gatcacatctacctccagcttagccatttgcccgctgagctcctgcacgagcgtctgccc
ggtatctccgagactgcctccattttctccggtgttgatgtcaccaagcagcccatccct
gtcctgcccaccgtccactacaacatgggcggtatccccaccaagtacactggtgaggtt
ctggatgtggatgagaacggccaggagaaggttgttcccggtctgtacgcctgcggtgag
gccgcatgtgtgtctgtccacggtgctaaccgcctgggtgccaactccctgcttgatttg
attgtcttcggccgtgctgtgtctcaccgtgtccgtgacattgccacccctggcaagccc
cacaaggagctttcttccgatgctggtgctcagtccatcaaggaccttgacttcgcccgt
accgccgatggccctaagtcgactttcgaagtccgcaacgctatgcagaggactatgcag
agcgatgtcagcgtcttccgtacccaagagagcttggatgagggtgtcgacaaggtcaac
aaggtcgatcagttgtactcccaggtcggcaccaaggaccgcagcatgatctggaactcc
gacttggtggagacccttgagctccgcaacttgctgacttgcgctacccaaaccgctgct
tccgctgccgctcgtaaggagtctcgtggtgctcacgcccgcgaggactaccccgaccgt
gacgacgagaagtggatgaagcacactctctcctggcagaagaagccccacggcgaggtc
aagctgggctaccgtgccgttgaggctaacaccttggatgctgaggagtgcaagccggtc
cctcctttcaagcgtacctactaa

DBGET integrated database retrieval system