KEGG   Penicillium rubens: Pc21g02320Help
Entry
Pc21g02320        CDS       T01091                                 

Definition
(RefSeq) Pc21g02320
Organism
pcs  Penicillium rubens
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 Shikimate_DH FAD_binding_3 Pyr_redox_3 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 8305441
NCBI-ProteinID: XP_002567296
UniProt: B6HJM6
LinkDB All DBs
Position
1
AA seq 351 aa AA seqDB search
MRAVRFHGRGDIRVDEVEEPICGNGQIRPAFVGLCGSDIHEYLAGPMIVPVTPHPLTDEK
LPTTLGHEFSGTVEEIGSGVTGFKVGDRVVVKPNLFDGTCSNCSLGIFNCCERVAFIGFS
SQAGGLSDHLVVDSRHAIPLPESIPLDIGALVEPLAVAWHAVSRSPLQRNDTVLVVGAGP
IGLAIIQVLKVKGITSIVAVEVSERRRGFALALGATEVLNPVDVDAVTQIRALTKNAGAD
VVFECSGAQAGLDTAVAGLRVRGTMVVVSLWEHRPTIDTFAVVFQEKNVIGAALYDDGDF
EAVMDEIASGGIQPRPMITSKIRMEDVDVRGFKALIEERDKHVKILVDISA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtgcgattccatggaagaggcgatatccgcgttgacgaggtcgaagagcca
atctgtggtaatggccagattcgacctgcctttgtcggattatgtggcagtgatatccat
gagtatcttgccggcccaatgatcgtgcctgtcaccccacatccattaaccgacgagaag
ctgccgaccactctgggccacgagttcagtggtacagttgaagagatcgggtcaggggtt
acagggttcaaggtcggagatcgggttgtagtcaagcccaacctcttcgacggcacgtgt
tcgaactgttcattgggcatattcaattgctgcgagagagttgcattcatcgggttcagc
agtcaggcaggtggtctatcagaccacttagtcgtggacagcagacatgctattccgcta
ccggagtccattccactcgacatcggtgccctggtggaacctctcgccgtcgcatggcac
gctgtaagccgcagtcctttgcagagaaatgacactgtacttgtggttggggctggacca
atcgggttggctattatccaggtactgaaagtcaaaggtattacctcaattgtcgccgtg
gaggtctctgagcgacgacgtggatttgccctggccctgggtgccaccgaggtccttaat
cccgttgatgtggatgcggttacgcagatacgtgccttgacaaagaacgcgggtgcagat
gttgtattcgagtgttccggagctcaggctgggcttgatactgcggtcgctggtcttcgg
gtacgtgggacgatggtcgtcgtttccttgtgggaacataggcctactatcgatactttt
gctgttgtgttccaggagaagaatgtcataggggctgctctttatgatgatggggacttc
gaggctgtgatggatgaaattgcttccggtggtattcagcctcgcccgatgatcacaagt
aagatccgaatggaggatgtggatgtgagagggttcaaagctctcatcgaagaaagagat
aagcatgtaaagatcctggtcgacatttctgcatga

DBGET integrated database retrieval system