KEGG   Penicillium rubens: Pc21g09900Help
Entry
Pc21g09900        CDS       T01091                                 

Definition
(RefSeq) Pc21g09900
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pcs  Penicillium rubens
Pathway
pcs00020  Citrate cycle (TCA cycle)
pcs00190  Oxidative phosphorylation
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01200  Carbon metabolism
Module
pcs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcs_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pc21g09900
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Pc21g09900
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Pc21g09900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 8304155
NCBI-ProteinID: XP_002568026
UniProt: B6HHM5
LinkDB All DBs
Position
1
AA seq 271 aa AA seqDB search
MASLRTTSRLFAASRPMFRPVFARTYATVEPTPSEQPKMKTFKVYRWNPDQPSEKPQMQS
YDLDLNKTGPMMLDALIRIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPTD
TKTESRIYPLPHTYVVKDLVPDMTHFYKQYKSIKPYLQRDTPTEDGLEFRQSPEDRKKLD
GLYECILCACCSTSCPSYWWNSEEYLGPAVLLQSFRWLADSRDEKTAERKAALDNSMSVY
RCHTILNCTRTCPKGLNPGRAIAEIKKMLAV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctccgtaccacttcgcgattgttcgcggcatcgcggccgatgttccgccct
gtcttcgctcgcacctacgcgactgttgagcctactccctccgagcagcccaagatgaag
accttcaaggtctaccgttggaacccggaccagcccagcgagaagccccagatgcagtcc
tacgacctcgacctgaacaagaccggacccatgatgctcgatgcgctcatccggataaag
aacgaactcgaccctaccctgactttccggagatcttgccgtgaaggtatctgcggttct
tgcgccatgaacattgacggtgttaacactctcgcctgcttgtgccgcatccccaccgat
accaagaccgagtcgcgcatctaccctttgcctcacacctatgtcgtcaaggaccttgtc
cctgatatgacccacttctacaagcaatacaagtccatcaagccatatctccagcgcgac
acccctaccgaagacggtctcgaattccgtcaatcccccgaggatcgcaagaagctcgac
ggtctctacgagtgcattctgtgcgcctgctgctcaacctcctgcccatcttactggtgg
aacagcgaggagtaccttggacccgccgtcctgctccagtccttccgttggttggccgat
tcccgtgacgagaagaccgccgagcgcaaggccgctctcgacaacagcatgagcgtttac
cgttgccacaccattctcaactgcacacggacttgccccaagggcctgaacccaggtcgc
gcaattgccgagatcaagaagatgttggctgtctag

DBGET integrated database retrieval system