KEGG   Penicillium rubens: Pc21g23200Help
Entry
Pc21g23200        CDS       T01091                                 

Definition
(RefSeq) Pc21g23200
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pcs  Penicillium rubens
Pathway
pcs00052  Galactose metabolism
pcs00500  Starch and sucrose metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Pc21g23200
   00500 Starch and sucrose metabolism
    Pc21g23200
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Pc21g23200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 8310192
NCBI-ProteinID: XP_002569287
UniProt: B6HI96
LinkDB All DBs
Position
1
AA seq 916 aa AA seqDB search
MKGSLFLLAPLVGSVLGSKSQLDSCPGYKASNVKQLGQRLTADLDLAGDACNIYGTDLPN
LKLLVEAQTETRLHVIIYDADEEVYQVPDSVLPRPQSAKGHQKESALRFDFEENPFSFRV
LREEEVLFDTSDTNIIFQSQYLNLRTWLPDDPNLYGLGEHTDSLRLPTTDYTRTIWNRDA
YSVPSDSNLYGTHPIYVDHRGENGTHGVFFLNSNGMDIKIDKTADGKQYLEYNTLGGVLD
FYFMAGPTPKEVSEQYSEVVGLPAMQSYWTFGYHNCRYGYQDVFDVAEVVYNYSRAGIPL
ETMWTDIDYMNVRRVFTLDEERFPIDKMRELVSYLHKHDQHYIVMVDPAVSNSDNGAFER
GHDQGIFLHRGNEQNELYQGAVWPGLTVYPDWFNKETQRYWNSEFERFFSPRDGVDIDGL
WIDMNEASNFCPYPCKNPAEYAQQNNLPPVPPPVRSPPRHIPGFPADFQPGSSLPGPFSK
YRVKRDDAVLELRSVGGKGSRMKAKKVGLPGRDLINPPYQIANAAGSISNKTIDTDIIHA
GEGYAEYVTHNLYGTSKSLVFIIGSFLISTLVMSSASREAMLKRRPNVRPLIITRSTFAG
AGSQVGHWLGDNFSQWDKYRVSIPQMLAFASIFQVPMVGSDVCGFAGNTTEELCARWAML
GGFYPFYRNHNEFGTIPQEFYRWPTVTEAAKKIIDIRYRLLDYLYTSFYRQTLTGTPFLQ
PLFYVYPEDSNTFGNELQFFYGDSILVSPVSEEGATSVDAYFPEDLFYDWFTGVAVQGEG
SVKTITDLVITDIPIHIRGGSIIPLRTASAKTTTDLRKRGFEILIAPNADGFAEGELYID
DGESIQPDSAADIQFKYRDGKLRIQGRFGYRPNVAVEAVTLLGQKNKRRDVGYDAQRQSV
TKKVQIELNGPAEVTL
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggctctttgtttctcctggctccccttgtgggttccgtcctgggatcgaaatcc
cagcttgacagttgtcctggttataaagcttccaatgtgaagcagttgggccagagattg
actgctgacctcgatcttgctggagatgcctgtaatatctatggcacggatcttccaaac
ttgaagctccttgtagaggcacaaactgaaacccgccttcatgtcataatctacgatgcc
gatgaggaggtctatcaagtaccagactctgttctccccaggccccagagtgcaaaaggc
catcaaaaggagtccgcccttcgcttcgacttcgaagagaatcctttctcattccgagtc
ttacgcgaggaggaagtgctcttcgatacttctgacaccaacatcatcttccagtctcag
tacttgaatttgcgcacttggcttcccgatgatccgaacctgtatggcctgggggagcac
actgattcgctgcgtctgcctaccactgactacactcgtactatctggaaccgtgacgca
tatagcgtcccctccgactcaaacctttacggtactcatcctatttacgttgatcaccgt
ggagagaatggcactcacggagtcttctttttgaactctaacggcatggacatcaagatt
gataagacagctgatggcaaacaataccttgagtataacacgctcggcggagtcctagac
ttctacttcatggccggtccgacccccaaggaagtgagcgagcagtactctgaagtcgtt
ggtctccctgctatgcaaagttactggacttttggataccacaactgccgatatggctac
caggatgtctttgatgtcgcagaggtagtttacaactacagccgtgctggaatcccactc
gagactatgtggaccgacattgactatatgaatgttcgacgggtattcactctagacgaa
gagcggttccctattgacaaaatgcgcgagttggtttcgtatctccacaagcatgatcag
cattatatagtcatggtcgacccggccgtcagtaactctgataatggtgctttcgaaaga
ggccacgaccagggaatcttcctgcaccgtggcaatgaacagaacgagctctaccaaggc
gccgtctggcccggcctaaccgtctatccagactggttcaacaaagagacacagagatac
tggaactccgaattcgagcgattcttcagcccaagagacggcgttgacatcgacggttta
tggatagacatgaacgaagcttccaacttctgcccatacccctgcaagaaccctgcagag
tatgctcagcagaacaacctacccccagtacctccaccagtccggtcgcctccacgccat
atcccgggtttcccggctgatttccagcccgggtcttccttacctgggcctttttctaag
taccgggtaaagagagacgatgcggtcctagagctacgtagtgtaggcgggaaaggcagt
cgtatgaaggcaaagaaggtcggattgcccggtcgagacctcattaacccgccttatcag
atcgcaaacgcggctggttccattagcaataagactattgatactgacatcatccatgct
ggcgagggctacgcagagtatgtcacgcacaatctctatggaaccagtaagtccctcgtc
ttcattatcggatccttcctaatatcaaccctagtgatgagctcggcttcccgcgaggca
atgctgaagcgtcgacccaacgtgcgccccttgattatcacgcgtagcactttcgccggg
gcaggctctcaggtcggccactggctcggcgataatttcagccaatgggataaataccgc
gtgtcaatcccacaaatgctagccttcgcttcgattttccaggtcccaatggttggtagc
gatgtctgtggcttcgccggaaatacgacggaagaactgtgcgcgcgctgggcaatgctc
ggcgggttctatccgttctatcggaatcacaacgagttcggtaccataccgcaggaattc
taccgctggcctactgtcacagaggctgcgaagaagattattgatatccgataccgtctg
ctcgattacctctatacttccttttaccgtcagaccttgacggggactccgttcctccag
ccgcttttctatgtctaccccgaggatagtaatacttttggtaatgagctgcagttcttt
tatggtgattccattctcgtctcgcctgtctcggaagagggcgctacctctgtcgatgcc
tatttccccgaggatctcttctatgattggtttactggtgtcgctgtgcagggcgaggga
tcggtgaagacgatcactgatctcgttattaccgatatcccgatccatatccgtggtggg
agtatcatccccctccgtacggcgagtgctaagaccacgacggatctgcgcaagcgcggc
tttgagattctcattgcgcctaacgctgatgggttcgcggagggtgagctgtatattgat
gatggcgagtcaattcagccggattccgcggcagatattcagttcaagtaccgggatggc
aagcttaggatccagggtcggttcgggtatcgtcctaatgtggctgttgaggctgttacg
ctgcttgggcagaagaataagcgtcgggatgttgggtatgatgctcagaggcagagtgtt
acaaagaaagtccagatcgagttgaatgggcctgccgaggtgacactgtga

DBGET integrated database retrieval system