KEGG   Penicillium rubens: Pc22g00970Help
Entry
Pc22g00970        CDS       T01091                                 

Definition
(RefSeq) Pc22g00970
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pcs  Penicillium rubens
Pathway
pcs00250  Alanine, aspartate and glutamate metabolism
pcs00410  beta-Alanine metabolism
pcs00430  Taurine and hypotaurine metabolism
pcs00650  Butanoate metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
Module
pcs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Pc22g00970
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pc22g00970
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pc22g00970
   00430 Taurine and hypotaurine metabolism
    Pc22g00970
Enzymes [BR:pcs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Pc22g00970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 8306589
NCBI-ProteinID: XP_002564142
UniProt: B6HPQ4
LinkDB All DBs
AA seq 512 aa AA seqDB search
MVHLAKVKKDNEVPPSTHDIVSVAPPDIDDFETNVYGSHFAADHMPLHEMPEREMPRQIA
ARMIKDELSLDGNPKLNLASFVTTYMEDEIEQIMTESFSKNFIDYEEYPHSAEIQNRCVN
MIARLFHIPTDASGENAMGTSTIGSSEAIMLGTLAMKKRWQNKRKAEGKDYSRPNIIMNS
AVQVCWEKAARYFEIEEKYVYCTDTRFVIDPKQAVDLVDENTIGICAILGTTYTGEYEDI
KAINDLLVERNIDCPIHVDAASGGFVAPFIQPDLKWDFRLEKVVSINVSGHKYGLVYPGV
GWVIWRSPEYLPQELVFNINYLGADQASFTLNFSKGASHVIGQYYQLIRLGKHGYRAIMS
NITRISDYMSSEFEKMGMVILSQTQGRGLPLVAWRLPTDDSRIYDEFAVAHQLRERGWIV
PAYTMAPNSEKLQMMRIVIREDFSMHRCDSLLQDFKLAIESLDAMDKSMLDKYKTHMKNH
RNHPRHQSRVHAHYMNEKHSLQGQTGKTHGVC
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggtccatctcgctaaagttaagaaggacaatgaggtcccaccctctactcatgacatt
gtctccgttgctcctccggacatagatgatttcgaaaccaatgtctacggcagtcacttt
gccgctgatcatatgcctctgcatgaaatgccagagcgagagatgcctcgccagattgca
gctcgtatgatcaaggatgagctgagtctggacggtaatcccaagctcaacctcgctagt
ttcgtcaccacctacatggaagacgagatcgaacagataatgaccgaatctttcagcaag
aactttattgattacgaggaatatccccactccgccgagatccagaaccgatgcgtgaat
atgattgctagactctttcatattcccactgatgcctccggtgagaatgccatgggtact
tcaaccattgggtcttccgaggctattatgctgggaacactggctatgaagaagcgatgg
cagaacaagcgcaaggctgagggcaaggactactcgcgtcccaacatcatcatgaacagt
gctgtccaggtctgctgggaaaaggctgctcgttacttcgagatcgaggagaagtacgtc
tactgcaccgacactcgcttcgtgatcgaccctaaacaggcagtcgatttggtggacgag
aacacaatcggtatctgcgctatcttgggtaccacctacaccggcgaatacgaggatatc
aaggcgatcaacgatctactagtggagcgtaatatcgactgcccaatccacgttgatgca
gctagtggtggctttgtcgctccattcatccagcctgatcttaagtgggacttccgcctg
gaaaaggtggtttccatcaacgtctctggtcacaagtatggtctggtctatcccggtgtc
ggatgggtcatctggcgctctccggagtatctaccccaggaattggtgttcaacatcaac
tatctaggggctgaccaggccagctttactttgaacttctccaagggcgcttctcatgtt
attgggcagtactaccagctgatccgcctgggcaaacacggttaccgcgcaattatgtcc
aacattactcgcataagcgactacatgtcttcagagtttgaaaagatgggcatggtcata
ttgagccagacacagggtcggggcctgccgctggtggcctggcgcctgcccacagacgac
agccgtatctacgatgaatttgctgtggcccaccagctacgcgagcggggctggattgta
ccagcgtacactatggcgcccaacagcgagaagctgcagatgatgcgcattgtcatccgc
gaagatttcagcatgcacagatgcgacagcttgctccaggacttcaaacttgctatcgag
tctttggatgctatggacaaatccatgcttgacaagtacaagacgcatatgaagaaccac
cgcaaccaccctcgacaccagtcgcgtgttcacgctcactacatgaacgagaaacactcg
ttgcaaggacagactggcaagacacatggagtgtgttag

DBGET integrated database retrieval system