KEGG   Penicillium rubens: Pc22g04890Help
Entry
Pc22g04890        CDS       T01091                                 

Definition
(RefSeq) Pc22g04890
Organism
pcs  Penicillium rubens
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 8310909
NCBI-ProteinID: XP_002564526
UniProt: B6HTX2
LinkDB All DBs
AA seq 667 aa AA seqDB search
MDSELRLSSPRLGSSIQINDQSNLQLGQFDPESQTFGSFRPPTEAESQLQNATHAFIRPP
RQGEPATNFITTSQSTQHQSHQGHPSNGLASHLQPQGQPSSGIHQSQGYNDGIAHAANMS
GALHGAAAGQMAPPASLSQNELAMGNNAHQANNSLTTLQSSSQPFQPDFTGLDPGPTDPV
AFTGPGELQGFKLVPNPPHLDYWRERLFNVDEMITLSEEEFQTYFPHVDNVYSHRSTQRY
KRKPFVSHYWDCRLKGRPPGTPKSDDPEKKKRKRTARERDLCHVKIKVVEYFPSSEIANT
THAVEPLPSNILPGMYTFSLNDDPAIRNAQTFGMLTPNPGLPPNHPGSNGGRYFTIQRVN
GNGANGKNDGVGGGHQHTLEESDRVKKSSVQRYVLKEKKDKRTRTDRIMSRAGQKSYHTK
ATGLAAETAIKHSADVNLRLYGSCFCPFVQRVWIALELKGIPYQYIEVDPYEKPQSLLEV
NPRGLVPALRHDDWGCYESSVLLEYLEDLGVGATMLPADPKLRAHCRLWADHVNRHIVPS
FYRILQEQDQQKQIEKTQELRDAMEKLLEAAHPKGPFFMGPQMSLVDIQAAPWIIRLRRV
LKPYRGWPDAEEGTRLASWVNAIETNQHVQATTSTDELYHDSYERYAQNRPNTSQVANAI
NAGRGLP
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggactctgagctgcgactgtcgtcgccccgcttgggatcttctatacagataaatgac
cagtctaatctacagttgggccaatttgacccggaatcgcaaaccttcgggtcattccgt
cccccgaccgaagctgaatcacagctccagaacgcgacgcatgcgtttattcgtcctccg
cgacaaggcgagcctgcgaccaacttcatcaccacgtctcagtccacacagcaccaatcg
caccaaggccaccctagcaatggacttgcctcgcacttacaaccgcaagggcaaccctcc
agtggtatacatcaatcgcagggctacaacgatggcatcgctcatgcagcgaatatgagc
ggtgcattacatggcgctgctgctggacaaatggcgcctccagcatcgctgtcccagaac
gagctagcgatgggaaacaacgcgcatcaagctaataacagcttaacaacactgcagtcc
tcaagtcaaccgtttcaaccggactttaccgggttagatcctggccctacggatccggtg
gccttcactgggcctggagagctgcaaggctttaaattggtgccgaaccctccacatctg
gactactggagagagaggttgttcaatgtcgatgaaatgatcaccctgagcgaagaggaa
ttccaaacatacttcccccacgttgacaatgtatactctcatcgctcaacacagcggtac
aagcgtaaacccttcgtctcccattactgggactgtcgactcaaaggacgaccgcctgga
acccccaaatccgatgacccagaaaagaagaagcgcaagcgtacggctagagaacgggat
ctctgccatgtcaaaatcaaagtcgtggaatacttcccatcctctgaaatagcaaataca
acccatgctgtcgagcccttgccatctaacatcctacctggcatgtatactttctctctg
aatgacgaccctgcgatccgaaatgcccaaacattcggtatgctcacgccgaaccctggt
ctaccaccaaatcatccgggatcgaatggtgggagatatttcactatacagcgggtgaat
ggtaatggtgccaacgggaagaatgacggagtaggtggtggtcatcaacatacgcttgag
gagagcgaccgtgtcaaaaagagtagtgtgcaacgatatgttctgaaggaaaagaaagac
aaaaggacgagaacggaccgaatcatgtctcgagcaggccaaaagtcataccatacaaaa
gcgacgggcctggctgctgaaactgcgatcaaacactccgccgatgttaatctcaggcta
tatgggagctgcttctgccccttcgttcaacgggtatggattgcattagaactgaaaggt
atcccgtaccagtacatcgaagtggatccgtatgagaagccccagtcgctattagaggtg
aatccaagaggacttgttcctgctttgcgacacgatgactggggatgctatgaaagcagc
gtgttgttggaatatctggaggacctgggtgtgggagctacaatgcttccagcagaccca
aagctgcgcgcccattgtcggttgtgggcggatcatgtcaatcggcatatcgtgccgagt
ttctaccgtatactgcaagagcaggaccaacagaaacagatcgagaagacacaggagctg
cgagacgcgatggagaagctgctcgaagcggcgcatcccaaggggcccttcttcatgggc
ccgcagatgtcccttgtggacattcaagctgccccgtggatcattcggctgcggcgggtg
ctgaaaccataccgaggatggccagatgctgaggagggaaccaggctggcctcttgggtg
aatgcaatcgagaccaaccagcatgtgcaggcgacaaccagcacggacgagctgtaccat
gacagctatgagcgatatgcccagaaccgcccaaacacatcccaggtcgcaaacgcaatt
aacgcaggacgaggcctcccttaa

DBGET integrated database retrieval system