KEGG   Penicillium rubens: Pc22g11650Help
Entry
Pc22g11650        CDS       T01091                                 

Definition
(RefSeq) Pc22g11650
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pcs  Penicillium rubens
Pathway
pcs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pc22g11650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcs02000]
    Pc22g11650
Enzymes [BR:pcs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Pc22g11650
Transporters [BR:pcs02000]
 Other Transporters
  Pores ion channels [TC:1]
   Pc22g11650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 8307359
NCBI-ProteinID: XP_002565111
UniProt: B6HQM0
LinkDB All DBs
AA seq 282 aa AA seqDB search
MPAHPDSNLYPEASGPAKTLVDQHRAEQPLKLYAGWFCPFVQRVWLALEEKKIPYEYIEV
NPYNKPDSLLKLNPRGLVPTLSTPAGPHPRPLYESTVILEYLEEAYPDHKPRFLPEDAYE
RARARIWIDYVSSRIIPSFHRFLQYQPADGSAQNPDAGLDQARQEFLNHLKTWTKEMHAE
GPFFLGGDIGLPDLVLAPWAVRLWAFDEFKNGGLGIPSEGKGGPEEEIWSRWRTWLAAIE
SRRSVKETTSDLAHYLPIYKRYADNTAQSELAKATRAGRGVP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgccggctcatcctgattccaacctctaccctgaggccagcggcccggccaagacgctg
gtcgatcagcatcgcgctgaacagccattgaagctgtatgcggggtggttctgtcccttc
gtgcaacgagtgtggctcgccctcgaagagaaaaagattccatatgaatatatcgaggtt
aacccatacaacaagccagactccctactcaaattaaatcccagaggcctagtccctaca
ctttcaacgccagcaggtccacacccacggccactgtatgaatccactgtgattctagag
tatctggaagaagcatacccagaccataaaccccgcttcctgccagaggatgcctacgag
cgtgcccgcgcacgtatctggattgactatgtgtcatctcggataatcccatcattccac
cgtttcttgcagtatcagcctgcagatggcagtgcccagaatccagatgcggggttggac
caggctcggcaagagtttttgaatcacctgaaaacctggactaaggagatgcacgccgaa
gggcccttcttccttggtggggatattggtctaccggatctggtgctggctccatgggcg
gtacgactgtgggcgtttgatgagtttaaaaatggtggattgggaattccgagtgaggga
aaagggggtccggaagaggagatttggagccggtggaggacttggctggcagccattgag
agcagaaggagtgtcaaggagaccactagtgatcttgcccattaccttcccatctacaag
agatatgcggataatacagctcaaagtgagttagctaaggcgacacgggctggcaggggg
gttccttga

DBGET integrated database retrieval system