KEGG   Penicillium rubens: Pc22g23550Help
Entry
Pc22g23550        CDS       T01091                                 

Definition
(RefSeq) Pc22g23550
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pcs  Penicillium rubens
Pathway
pcs00010  Glycolysis / Gluconeogenesis
pcs00051  Fructose and mannose metabolism
pcs00052  Galactose metabolism
pcs00500  Starch and sucrose metabolism
pcs00520  Amino sugar and nucleotide sugar metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01200  Carbon metabolism
Module
pcs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pcs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc22g23550
   00051 Fructose and mannose metabolism
    Pc22g23550
   00052 Galactose metabolism
    Pc22g23550
   00500 Starch and sucrose metabolism
    Pc22g23550
   00520 Amino sugar and nucleotide sugar metabolism
    Pc22g23550
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pc22g23550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcs04131]
    Pc22g23550
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Pc22g23550
Membrane trafficking [BR:pcs04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Pc22g23550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8309242
NCBI-ProteinID: XP_002566246
UniProt: B6HVU2
LinkDB All DBs
AA seq 494 aa AA seqDB search
MSSSLLDQATRIARDFDYPAEKVQRGVAEYIKQSNEGLTKEGTTLSQIPTFVTAVPNGTE
KGLYLAVDLGGTNFRVCSVLLHGDTTFSLTQSKILIPRELMASGTSKDLFLFLARQIEAF
LRIHHNEHFEAHLLRRREGNTEEDLFDLGFTFSFPVRQCGINRGTLIRWTKGFNIPDAVG
HDVCALLQSAIDELSLPVRVAALVNDTVGTLMARSYTSPGETGTFIGAIFGTGTNGAYVE
KTKNITKLQHMKDAHFEDSTGEMIINAEWGSFDNHMSVLPTTVFDDELDADSNNPGVQMF
EKRVSGMFLGEILRRALLSLYRADLGLFQANKDSKVVLPEGSMLFRQWGLDTSMLSSVEA
DTSEDLVDVKTALKDHLEIENPSLEECQAVKTIVHAIGKRAARLSAVPLAAIVVHSNKLQ
TDDMIDIGVDGSLVEFYPNFEGHLREALREVPEVGAAGDKRIRIGISKDGSGVGAALIAL
VANKTEGFEIPREN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttcactattggaccaagctacgcgcattgcgcgtgacttcgactaccccgcc
gagaaagtgcagcgcggggttgccgagtacatcaagcagtctaacgagggcttgaccaaa
gagggcaccaccttgagccaaatccctactttcgtgactgcggtgccaaatggcacagaa
aagggtctttacttggctgttgatctcggtggcactaacttccgtgtgtgctcggtcctc
ctgcacggcgacaccaccttctccctcacccagtccaagatcttaattcctcgggaattg
atggcctctggcacatcaaaggatctcttcctgttcttggcccgtcaaatcgaggcattc
cttcgcattcaccacaacgaacacttcgaggcccacctgctccgccgacgggagggtaac
accgaagaggacctgttcgatctgggctttaccttcagtttccctgtgcgccagtgtggg
atcaaccgcggaacacttatccgctggaccaagggcttcaatatccccgatgcggttggt
cacgatgtttgcgcgctgcttcagtccgccattgatgagttgagcctgccagtgcgcgtg
gctgcgttagtgaacgacaccgtcggtactctcatggcccgctcatacacctcgccaggc
gagactggcactttcattggtgccattttcggaaccggtaccaacggtgcttacgtggag
aagaccaagaacatcaccaagctccagcatatgaaggatgcccactttgaagactccaca
ggcgagatgattatcaacgctgagtggggtagcttcgacaaccacatgagcgttctccct
accaccgtgttcgacgatgagctcgatgccgacagcaacaaccccggtgtgcagatgttc
gaaaaacgtgtttcaggcatgttcttgggcgaaattctccgccgcgcgctcctgtctctc
taccgtgccgacctgggactgttccaggccaacaaggactccaaggtcgtccttcctgaa
ggatccatgcttttccgtcaatggggtcttgacaccagcatgctgagttcagtcgaagct
gataccagcgaggacttggtggatgtgaagactgcattgaaggatcacctcgagattgag
aaccccagcctcgaagagtgccaggctgtgaaaaccatagttcacgccattgggaaacgt
gccgctcgcctgagcgctgtcccgttggctgctattgtcgtgcacagtaacaagcttcag
actgatgatatgattgacattggtgtcgatggcagcctcgttgaattctaccccaacttt
gaagggcatttgcgtgaggctttgcgcgaagttcccgaagttggagctgcaggcgacaag
aggatccgtattggcatttccaaggatggcagcggtgttggcgcagctctgattgcgctc
gtcgctaacaagaccgagggctttgaaattccccgcgagaactaa

DBGET integrated database retrieval system