KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0059Help
Entry
PC1_0059          CDS       T00934                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00053  Ascorbate and aldarate metabolism
pct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    PC1_0059
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     PC1_0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C 3HCDH_N Sacchrp_dh_NADP Pyr_redox_2 NAD_binding_7 FAD_binding_3 AdoHcyase_NAD HI0933_like TrkA_N adh_short Shikimate_DH GIDA Pyr_redox_3 Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACT11121
UniProt: C6DGN4
LinkDB All DBs
Position
complement(69804..70826)
Genome map
AA seq 340 aa AA seqDB search
MSTMNTLICQEPKKLIWKKREIPIPGEGETLIKIKSVGICGTDIHAWGGNQPFFSYPRVL
GHEICGEVVDTGKNVHQFKKGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGF
SEYLAVPATNVLLAEGIDPQAAALIEPYAISAHAVRRAKVLQGEQVLVVGAGPIGLGAAA
IAKADGAHVVVADTSAARREHVIAHLNLSVVDPSAEDFEAQLRAEFGGSLAEKVIDATGN
QHAMNNTINLIRHGGSIVFVGLFKGDLQFSDPDFHKKETTMMGSRNATPEDFSKVGRLMS
EGKLTAEMMLTHRYSFSTLADIYEKDVINNRELIKGVITF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaatgaatacattgatttgccaggaaccaaaaaaacttatctggaaaaaacgt
gaaatacctattccgggtgaaggtgaaacattaattaaaattaagtctgtgggtatttgt
ggcacagatattcatgcctggggagggaatcaacccttttttagctacccacgcgtatta
ggccacgaaatatgtggagaggttgtcgatacgggcaaaaatgtacatcaatttaaaaaa
ggccagcaggttgccgtcattccctatgtcgcctgtcagcaatgtcctgcctgcaagagc
ggccgtaccaactgctgcgagaaaatttcagtgattggtgtacatcaggatggcggattt
agcgaatatctggcggtgcccgccacaaacgtattgcttgcagaagggatcgacccacag
gcggcggcgttaatcgagccctacgccattagtgcgcacgccgttcgtcgggcaaaggtg
ctacaaggtgaacaggtgctggtcgtcggtgccggaccgattggccttggcgcagcagcc
atcgccaaagcagacggcgctcacgtggttgtcgcagacaccagtgcagcccgccgcgag
cacgttattgcccacctgaatctttcggtcgtcgatccctcagccgaggattttgaggcc
cagctacgcgccgaatttggcggttcgctggcagaaaaagtcatcgatgccacgggaaat
cagcatgcgatgaacaacaccattaacctgatccgccacggtggcagcatcgtgtttgtc
ggtctgtttaaaggtgatttacagttctccgatcctgacttccataagaaagagaccacg
atgatgggcagtcgtaacgccacaccggaagatttctccaaggtaggacgtttgatgtct
gaaggtaaactcaccgcagaaatgatgctgacgcaccgttattccttttccacactggct
gacatctatgaaaaggatgtcattaacaaccgtgagctgatcaaaggcgtcatcacattt
taa

DBGET integrated database retrieval system