KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0198Help
Entry
PC1_0198          CDS       T00934                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
KEGG Orthology (KO) [BR:pct00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pct03012]
    PC1_0198
   03029 Mitochondrial biogenesis [BR:pct03029]
    PC1_0198
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pct04147]
    PC1_0198
Translation factors [BR:pct03012]
 Eukaryotic Type
  Elongation factors
   PC1_0198
 Prokaryotic Type
   PC1_0198
Mitochondrial biogenesis [BR:pct03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PC1_0198
Exosome [BR:pct04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PC1_0198
  Exosomal proteins of breast cancer cells
   PC1_0198
  Exosomal proteins of colorectal cancer cells
   PC1_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ACT11258
UniProt: C6DG79
LinkDB All DBs
Position
234227..235411
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVVRGSALKALE
GEAEWEAKIIELAEHLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggtaacgcacgtgcattcgaccagatcgataacgcaccagaagaaaaagcacgtggt
atcaccatcaacacgtctcacgttgaatacgataccccgtctcgccactacgcgcacgtt
gactgcccaggacacgccgactatgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgctatcctggttgttgctgcgactgacggcccaatgcctcagacgcgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtgttcctgaacaagtgtgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccaggcgacgacaccccagtggttcgtggttcagccctgaaagcgctggaa
ggcgaagctgagtgggaagctaaaatcatcgaactggcagagcacctggattcttatatc
ccagagccagagcgtgcaattgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcgttaaagttggt
gaagaagttgaaatcgttggtatcaaagataccgcgaaatctacttgtactggcgtagaa
atgttccgcaaactgctggacgaaggccgtgcgggtgagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagaaatcgagcgtggtcaggtactggctaagccgggttcaatcaag
ccacacaccaagttcgaatcagaagtgtatatcctgagcaaggatgaaggcggccgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacgactgacgtaacgggc
accatcgaactgccagaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccaatcgcgatggatgacggtttgcgtttcgcaatccgtgaaggc
ggccgtacagtaggcgcgggcgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system