KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0745Help
Entry
PC1_0745          CDS       T00934                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00030  Pentose phosphate pathway
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01200  Carbon metabolism
pct01230  Biosynthesis of amino acids
Module
pct_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pct_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PC1_0745
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    PC1_0745
Enzymes [BR:pct01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     PC1_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: ACT11799
UniProt: C6D9L3
LinkDB All DBs
Position
complement(868835..870829)
Genome map
AA seq 664 aa AA seqDB search
MSSRKELANAIRALSMDGVQKAKSGHPGAPMGMADIAGVLWRDYLNHNPANPNWANRDRF
VLSNGHASMLIYSLLHLSGYDLPIEELKNFRQLHSKTPGHPEYGYTAGVETTTGPLGQGI
ANAVGMAIAERTLAAQFNRPGHEIVDHHTYAFLGDGCMMEGISHEVCSLAGTMKLGKLTA
FYDDNGISIDGHVEGWFTDDTAARFEAYGWHVVRGVDGHDADAIKRAIGEAQLVTDKPSL
LMCKTVIGFGSPNKAGTHDSHGAPLGDAEVAASREQLGWTHAPFEIPADIYAAWDAKPAG
QRKEAAWNEAFAAYASAYPELAAEFTRRTGGELPTNWQADAQKFIEDLQANPAKIASRKA
SQNALEAYGKLLPEFLGGSADLAPSNLTIWSGSVSLDKDHAGNYLHYGVREFGMTAIANG
IALHGGFVPYTATFLMFVEYARNAVRMAALMKIRSIYVYTHDSIGLGEDGPTHQPVEQLA
SLRVTPNMSNWRPADQVETAVAWKYAIERQDGPTSLILSRQNLAQQPRTAEQLANVAKGG
YVLKDSDGQPELILIATGSEVELAVGAYDKLTAAGRKVRVVSMPSTDAFDKQDAAYREAV
LPKAVSARVAIEAGIADYWFKYVGLNGAIVGMTSFGESAPAELLFEEFGFTVDNVVEKAQ
ALLQ
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcgtaaagaacttgccaatgctatccgcgcgctgagcatggatggggtgcag
aaagccaaatccggtcacccgggcgcaccgatgggcatggccgatatcgccggagtcctg
tggcgcgattacctcaaccataatccggccaaccccaactgggccaaccgtgaccgcttc
gtgctgtccaacggccacgcgtccatgctgatttacagcctgctgcatctctccggctac
gacctgccgattgaagaactgaaaaacttccgccagctgcattccaaaaccccgggtcac
ccggaatacggctataccgccggcgttgaaaccaccactggtccactggggcagggtatc
gctaacgcagtcgggatggcgattgccgagcgcacgctggcggcgcagttcaaccgtccg
ggtcacgagattgtcgaccatcacacctacgccttcctcggcgacggctgcatgatggaa
gggatttcccacgaagtctgctcgctggccggcaccatgaagctcggcaagctgaccgcg
ttttatgatgacaacggcatctccatcgacggccacgttgaaggctggtttaccgacgat
accgccgcccgttttgaagcctacggctggcacgtggtgcgcggcgtggacggccacgat
gcggacgccatcaagcgtgccatcggtgaagctcagctggtgaccgacaagccgtcgctg
ctgatgtgcaaaaccgtgattggcttcggttccccgaacaaggccggtacgcacgactcc
cacggtgcgccgctgggggatgcagaagtggcggcctcccgcgaacagctgggctggacc
cacgcgccgtttgagattcctgctgatatctatgccgcctgggatgcgaaaccggccggt
cagcgtaaggaagccgcctggaacgaggcgtttgccgcctacgccagcgcgtacccggaa
ctggctgccgagttcacacgccgcaccggcggcgaactgccaaccaactggcaggcggac
gcgcagaaatttatcgaagacttgcaggccaacccggcgaaaattgccagccgcaaagcc
tcacagaacgcgctggaagcctacggcaaactgctgccggaatttctgggcggttcagcc
gacctggcaccgagcaacctgaccatctggtccggctcggtatcgctggataaagaccac
gcgggcaactacctccactacggcgtgcgcgaattcggcatgacggcaattgccaacggg
attgcgctgcacggtggctttgtgccgtacaccgcgaccttcctgatgtttgtggaatat
gcccgtaacgccgtgcgtatggccgcactgatgaaaatccgcagcatctacgtctacacc
cacgactccatcggtctgggcgaagacggcccgacgcaccagccggttgaacagctggcc
agcctgcgcgtgacaccgaacatgagcaactggcgtccggcggaccaggtggaaacggcg
gtggcgtggaaatacgcgattgagcgtcaggacggtccgacgtcactcatcctgtcccgt
cagaatctggcgcagcagccacgtactgctgagcagttggcgaacgtggcgaaaggtggc
tacgtgctgaaagacagcgacggccagccggagcttatcctgattgccaccggctctgaa
gtcgagctggctgtcggggcgtatgacaagctgactgccgcaggccgcaaggtgcgcgtg
gtgtcgatgccatcaacggatgcattcgacaagcaggatgcagcctaccgtgaagcggtg
ctgccgaaggcggtatcggcacgcgtggcgattgaagcgggtatcgcagactactggttc
aagtatgttggcctgaacggcgcgattgtcggcatgacgagcttcggcgaatcggcaccg
gcggagctgctgttcgaagagttcggcttcaccgtcgataacgtggtggaaaaagcgcag
gcgctgctgcaatag

DBGET integrated database retrieval system