KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0803Help
Entry
PC1_0803          CDS       T00934                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00040  Pentose and glucuronate interconversions
pct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PC1_0803
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     PC1_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ACT11857
UniProt: C6D9S1
LinkDB All DBs
Position
936599..937630
Genome map
AA seq 343 aa AA seqDB search
MKSIVIQQPNALVIEERPIPQPAAGEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHE
FFGVIEAVGEGVDASRLGERVSVDPVVSCGHCYPCSIGKPNVCTSLVVLGVHRDGGFSEY
AAVPAKNAHVIPDDIPDEFAVMVEPFTISANVTAQVKPTEQDVALIYGAGPMGLTSVQVL
KGVFKVKDVIVVDRIPERLEMALRSGADRVINNASLSLKDELEALNIKPTLIIDAACHPS
ILQEAITIASPAARIAIMGFSSEPCQVSQQGITSKELSIFSSRLNANKFPVVIAWLKEKR
IDPAKLITHRFDYQQVVEAIEVFEKDQKRCCKVLLTFNETGQI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcattgtgatacagcaaccgaatgcgttggtgattgaagaacgcccgattccg
caaccggcggcaggcgaagtgcgggtgaaggtgaagctggcgggcatctgtggttcggat
agccacatctatcgcgggcataacccctttgccaagtacccgcgtgtgatcgggcatgag
ttctttggtgtgattgaggcggttggtgagggtgtggacgcgtcccggctgggcgaacgc
gtgtcggtcgacccggtcgtgagctgcggccactgctacccgtgttcaatcggcaagccg
aacgtctgtacttcgctggtggtactgggtgtgcaccgtgatggcgggttcagcgagtac
gctgccgtaccggcgaagaatgcacacgtcattcccgatgacattcctgatgagttcgcc
gtgatggtggagcccttcacgatttccgccaatgtgactgcgcaggtgaaaccgacggag
caggatgtcgctctgatttatggtgcggggccgatggggttgacctccgtacaggtactg
aaaggcgtgttcaaggtgaaggacgtgattgtcgttgaccgcattcccgagcgcctggag
atggcattacgcagcggagcggacagagtcatcaacaacgcgtcgctgtcattaaaagac
gaactggaagcgctgaatatcaagcctacgctgattattgatgccgcctgccatccatct
attttgcaggaagcgattacgattgcctctccggcagcgcgtatcgccatcatgggcttt
tccagcgaaccttgtcaggttagccagcagggcatcaccagcaaagagctctccatcttc
tcatcacggttgaatgccaataaattccctgtcgtgattgcgtggctgaaagagaaacgt
atcgatccggccaaactgattacccatcgatttgattatcagcaggtggtcgaggcgata
gaagtctttgaaaaagatcaaaagcgctgctgcaaagttctgctgacgtttaatgaaact
ggacagatataa

DBGET integrated database retrieval system