KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1258Help
Entry
PC1_1258          CDS       T00934                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00010  Glycolysis / Gluconeogenesis
pct00260  Glycine, serine and threonine metabolism
pct00680  Methane metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01200  Carbon metabolism
pct01230  Biosynthesis of amino acids
Module
pct_M00002  Glycolysis, core module involving three-carbon compounds
pct_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_1258
  09102 Energy metabolism
   00680 Methane metabolism
    PC1_1258
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PC1_1258
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pct04131]
    PC1_1258
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pct04147]
    PC1_1258
Enzymes [BR:pct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PC1_1258
Membrane trafficking [BR:pct04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PC1_1258
Exosome [BR:pct04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PC1_1258
  Exosomal proteins of melanoma cells
   PC1_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACT12306
UniProt: C6DCF6
LinkDB All DBs
Position
complement(1466197..1466949)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRSEAKAAGQLLKDEGFAFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTRDDERFPGHDPRYASLSDKELPLTESLALTIERVVPYWNETILPRIKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtaagacacggtgagagccagtggaacaacgaaaac
cgcttcacgggctggtacgatgtcgatctgtccgacaaaggccgttcagaagccaaagcc
gcaggtcagctgctgaaagacgaaggttttgcctttgatttcgcgtatacctccgtgctg
aaacgtgccattcacacactgtggaacgtactggacgagctggatcaagcctggttgcca
gttgaaaaatcctggaaactgaacgagcgccactacggtgcgctgcagggtctgaacaaa
gccgaaaccgctgagaaatacggtgacgagcaggttaaacaatggcgtcgtggtttcgca
attacgcctccagagttgacgcgtgatgacgaacgtttccctggccacgatccgcgttac
gcttctctgagcgacaaagagctgccgctgactgaaagcctggcgctgaccatcgaacgt
gttgtgccttactggaatgaaaccatcctgccacgcatcaagagcggcgagcgcgttatc
atcgcggctcacggtaactcactgcgtgcactggtgaaatacctggacaacatgggcgaa
gacgaaattctggaactgaatatcccaactggcgtgccgttggtttatgagttcgacgag
aacttcaagccaatcaaacgttactacctgggcaacgcagacgaaatcgctgcaaaagct
gctgcagtagcaaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system