KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2233Help
Entry
PC1_2233          CDS       T00934                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00250  Alanine, aspartate and glutamate metabolism
pct00410  beta-Alanine metabolism
pct00640  Propanoate metabolism
pct00650  Butanoate metabolism
pct01100  Metabolic pathways
pct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PC1_2233
   00650 Butanoate metabolism
    PC1_2233
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PC1_2233
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PC1_2233
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pct01007]
    PC1_2233
Enzymes [BR:pct01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PC1_2233
Amino acid related enzymes [BR:pct01007]
 Aminotransferase (transaminase)
  Class III
   PC1_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACT13271
UniProt: C6DJ01
LinkDB All DBs
Position
complement(2564897..2566162)
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRLAATPRGVGVMCDFYAERAENSTLWDVEGREFIDFAAGIAVLNTGHRHPK
IVTAVREQLDCFTHTAYQIVPYGSYVTLAERINALAPIEGAAKTTFFTTGAEAVENAVKI
ARAYTKRPGVIAFNAAFHGRTLLTMTLTGKVAPYSTGFGPFPGSIFHALYPSEQHGITVE
QALESVERLMHTDIAADQVAAILLEPVQGEGGFNVAPPAFISGLRKLCDEHGILLIADEV
QTGFARTGKLFAMEYYAEKADLITMAKSLGGGFPISGVVGRADVMDAPAPGGLGGTYAGN
PLSVASALAVLDVIEEEKLCQRAQRLGAALVETLEKIKAQCPALVAIRAQGSMVAAEFND
PHTGKPSAEVTRQFQKSALEAGLLLLTCGVHGNVIRFLYPLTVPDDQFSKAMSILTRVFT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagcgaactgaatcaacgccgtctggccgccacgccgcgtggtgtgggcgtc
atgtgtgatttctatgctgagcgtgcggaaaacagcaccctgtgggatgttgaaggtcga
gaatttatcgatttcgccgccgggattgcggtactgaacaccggccaccgccatccgaaa
attgtcaccgcggtgcgtgagcaactggattgctttacccatacggcgtaccagattgtg
ccttacggcagctacgtcacccttgccgaacgcatcaatgcgctggcgccgattgaaggc
gcggcaaagactacgttctttaccaccggagccgaagcggtggaaaacgcggtgaaaatt
gctcgcgcctacaccaaacgccccggtgtgattgccttcaacgccgcgtttcacggccgc
acgctgctgaccatgacgctaacgggcaaagtggcaccgtactccacaggattcgggccg
ttccccggctccattttccacgcgctttaccccagtgaacagcacggcattaccgttgag
caggcgttggaaagcgttgaacgtctgatgcataccgatatcgccgccgatcaggttgcc
gccattctgctggagccagtgcaaggcgaaggtggtttcaacgtcgcaccaccggccttt
attagcgggctacgtaaactgtgcgatgagcatggcatcctgctgattgctgatgaagtg
cagacgggctttgcccgtaccggcaagctgttcgcgatggaatattacgcggagaaagcg
gatctgatcacgatggcaaaaagtctgggcggcggtttcccgatctccggcgttgtcggt
cgtgctgacgtcatggacgcacctgcgccgggcggactgggtggcacctatgcgggtaac
ccgctgtcggtggcctccgcgctggcggtattggacgtgattgaagaagagaaattgtgc
cagcgggcacagcgtctgggtgccgcgctggtggaaacgctggagaaaatcaaagcgcag
tgtccggcactggtggcgattcgtgcgcaggggtcgatggtagcggcggaatttaacgat
ccgcacaccggaaaaccgtcggcggaggtgacccgtcaatttcagaaaagtgcgttggaa
gccggtctgctgctgctgacctgcggtgtacatggcaacgtgattcgtttcctgtatccg
ttaacggtacctgacgatcagttcagtaaggccatgagcatcctgacgcgcgtatttaca
cgatag

DBGET integrated database retrieval system