KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3729Help
Entry
PC1_3729          CDS       T00934                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
KEGG Orthology (KO) [BR:pct00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PC1_3729
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PC1_3729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin FAD_binding_3 NAD_binding_8 Thi4 DAO K_oxygenase Lycopene_cycl DSBA AlaDh_PNT_C Antiterm FMO-like
Motif
Other DBs
NCBI-ProteinID: ACT14744
UniProt: C6DFK5
LinkDB All DBs
Position
complement(4209828..4211390)
Genome map
AA seq 520 aa AA seqDB search
MLDNTMKVQLKAYLEKLTKPVELIATLDDSAKSAEVRTLLTEIAELSERVSFVEKNELAV
RKPSFLITNPGSQSGPRFAGAPMGHEFTSLILALLQVGGHPSKEAKELLDQIRNLDGAFH
FETYYSLSCHNCPDVVQALNLMAVLNPNITHTAIDGGVFQDEIQSRNVMGVPTVFLNGEH
FSQGRTSLAEIVTKIDTGAGAKQVEKLNQRDVYDVLIIGSGPAGAAAAVYSARKGIRTGL
VGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPGGEPG
KPHQVITVSGATLKARSVIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKVRSLPNVDIILNAQTTEVKGD
GQKVTGLSYKDRITDTVHDLALEGIFVQIGLLPNTHWLEGTVARNRIGEIEIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatacgatgaaagtccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttgattgcgactctggatgactccgcgaaatctgctgaagtcagaaccttgctg
actgaaatcgctgagctgtctgaacgggtaagttttgttgaaaagaatgagttggcagta
cgtaagccttcattcctgattaccaatccaggttcccagagcggcccgcgttttgccggt
gcgccaatgggacatgagtttacctccctgattctggcgttattgcaggtgggcggccat
ccgtcgaaagaagcgaaagaattactcgatcaaatacgtaatcttgacggtgcgttccac
tttgaaacgtattactcgctgtcctgccacaactgcccggacgtggtgcaggcactgaat
ttaatggcggtgctgaatccgaatatcacccataccgcgattgacggtggtgtgtttcag
gatgaaatccaaagccgcaatgtcatgggtgttccgaccgttttcctgaacggcgaacac
tttagccaggggcggacgagcctcgcagagattgtgactaaaatcgataccggcgcgggc
gctaagcaggtcgagaagctgaaccagcgtgacgtctatgacgtgttaatcatcggtagc
ggcccagcaggggcagccgcggcggtctattcggcgcgtaaaggtattcgtaccggtttg
gtcggtgaacgttttggcggtcaggtattggatacggttgatatcgaaaactacatttct
gttccgaaaacggaaggtgccaaactggcgaccgcgctgaagagccatgttgatgactac
gatgttgatgtgatcgatgcgcagagtgcagaagccctaattcccggtggcgaacccggc
aagccgcatcaggtgataaccgtatccggtgcgacgctgaaagcgcgtagcgtgattatt
gcaaccggcgcgcgctggagaaacatgaatgtacccggcgaagatcagtaccgtacgcgc
ggtgtaacgtactgtccgcactgtgacggtccgctgtttaaaggcaaacacgtcgcggtg
attggcggcgggaactccggtgtggaagcggctatcgatctggctggcgtggtgaaacat
gtcacgctgcttgagtttgcgccggaactgaaagcggattcggtattgcaggacaaggtg
cgtagcctgccgaacgttgacatcattctgaatgcgcaaaccacagaagtgaaaggtgat
ggacagaaggtaacggggctgagctacaaagatcgtattaccgatacggtgcacgattta
gcgctggaagggatcttcgtgcagattggcctactgcctaacacccactggctggaagga
acggtagccagaaaccgcatcggtgaaatcgagatcgatgccaaatgcgaaaccagcgtg
aaaggggtctttgctgccggcgactgtacgaccgtgccgtacaagcagatcatcattgcg
acgggtgaaggcgcaaaagcgtccctgagcgcctttgactacctgattagaactcgtgcg
taa

DBGET integrated database retrieval system