KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_4065Help
Entry
PC1_4065          CDS       T00934                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00620  Pyruvate metabolism
pct00680  Methane metabolism
pct01100  Metabolic pathways
pct01120  Microbial metabolism in diverse environments
pct01200  Carbon metabolism
Module
pct_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PC1_4065
  09102 Energy metabolism
   00680 Methane metabolism
    PC1_4065
Enzymes [BR:pct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PC1_4065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACT15080
UniProt: C6DI86
LinkDB All DBs
Position
4596925..4599564
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGENILDKVETIRKLSKSSRAGNEKHRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHTISPHGEAASNPAQLSSAFERLKESKDLTER
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDLADYERNQIMRRLRQ
LIAQSWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQLEQAFGYRLPVDA
VPVRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLRDIQVLVSELSMSECTPELL
ELAGGSEVQEPYRAIMKSLRSQLSSTLSYLEARLTGEERLPPKDLLITNEQLWEPLHACY
QSLKSCGMGIIADGRLLDTLRRVRCFGVPLVRIDVRQESTRHTEALAEITRYLGLGDYES
WSESDKQAFLIRELSSKRPLLPRYWEPSADTKEVLDTCRVIAKAPQGSIAAYVISMARTP
SDVLAVHLLLKEAGCSFALPVAPLFETLDDLNNADDVMTQLLSIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLALYTGAILEANLLPPPEPKQEWHEVMDEL
SRVSCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVDDGKQEQLEEMCRDWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVDEKLWPLGKQLRDQLAADINIVLAISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEKPDADLELALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgcagtaacgtcagtatgctcggcaaactgctcggc
gacaccatcaaggaagcgctgggtgaaaatatccttgataaagtcgaaacaatccgcaag
ctgtcaaagtcttcccgcgcaggtaatgaaaaacatcgtcaggagttgctgaccacgctg
caaaacctgtctaacgatgaactgttgcccgttgcccgcgcattcagccagttccttaac
ctgaccaataccgctgagcaatatcatacgatttcaccgcacggtgaggcagcgagcaac
ccggcacagctttccagcgcctttgagcgtctgaaagaaagtaaagatctgaccgagcga
gatatccgtgacgccgtggaatcgctgtcgatcgaactggtgctgaccgcacacccgacc
gaaattacccgccggacgctgatccacaagctggtggaagtgaatacctgcctcaagcag
ctcgaccataacgatctggctgattatgaacgcaatcagatcatgcgtcgcttgcgccag
ctgatcgcgcagtcctggcacaccgatgagatccgtaaaattcgtcctaccccggtagat
gaagccaaatggggcttcgccgtggtggaaaacagcctgtgggaaggcgtccccgcgttt
ttacgcgagctggatgagcagttggaacaggctttcggctaccgtctgcccgttgacgcc
gttccggtacgctttacttcctggatgggcggcgaccgtgacggtaacccgaacgtgacg
gcagaagtgactcgccatgtgctgttactcagccgctggaaagccgccgatctgttcctg
cgtgatattcaggtgctggtttccgagctgtcgatgtccgaatgtacgccggagttgctg
gagctggctggtggtagcgaggttcaggaaccgtaccgcgccatcatgaaatcactgcgt
tcacagctgagcagtacgctgagctatctggaagcacgtctaacaggcgaagaacgtctg
ccacccaaagacctgctgattaccaacgaacagctttgggaaccgctccacgcctgctac
caatcactgaaatcctgcggcatgggcatcatcgccgatggtcgcctgctggatacgtta
cgtcgcgtgcgctgcttcggtgtgcctttggtccgcatcgatgtccgtcaggaaagcacc
cgtcacaccgaagcgctggctgaaattacccgctatctgggtctgggcgactacgaaagc
tggtcagagtccgacaagcaagccttcctgatccgcgaacttagctccaagcgtccgctt
ctgccgcgctactgggaacccagcgcggataccaaagaagtgctggatacctgtcgggtc
atcgctaaagcgccgcagggctctatcgccgcctacgttatttcaatggcacgcacgcct
tccgatgtgctggccgttcacctgctgctcaaagaagcgggctgctcgtttgccctgccg
gtcgcgccgctgtttgaaacgctggacgacctgaacaacgccgatgatgtcatgacgcaa
ttgctaagcatcgactggtatcgcggctttattcagggcaagcagatggtcatgatcggt
tattccgactccgcaaaagacgcgggcgtgatggccgcttcctgggcgcagtaccgtgca
caggatgccctgatcaaaacctgcgagaaagcgggtatcgcactgacgctgttccacgga
cgtggcggttccatcggtcgcggcggcgcgccggctcatgccgcgctgctgtcacaaccg
ccgggcagcctgaaaggcggcctgcgcgtgaccgaacagggcgagatgatccgctttaaa
tacggcctgccggaagtcaccatcagcagtctggcgttgtataccggtgcgattctggaa
gcgaacctgctgccaccaccggaaccaaaacaagaatggcacgaggtgatggatgaactg
tcccgcgtgtcctgtgatatgtaccgtggatacgtgcgtgagaacccggatttcgttcct
tacttccgcgctgcgacgccagagctggaactgggcaaactgccgctggggtcacgtccg
gccaagcgtcgtccgaacggcggcgtagaaagcctgcgcgctatcccgtggattttcgcc
tggacgcagaaccgtctgatgctgccagcctggctcggcgcgggtgccgcgttgcagaaa
gtggttgatgacggcaaacaggaacagctggaagagatgtgccgcgactggccgttcttc
tcaacgcgtatcggtatgctggagatggtgttcgccaaagccgacctgtggctggcggaa
tattacgatcagcgtctggtcgacgagaagctgtggccgttagggaaacagctgcgcgat
cagctggccgccgacatcaacatcgtgctggcgatctctaacgacgatcacttgatggcg
gatctgccgtggatcgcggaatcgatcgccttgcgtaacgtctacaccgatcccctgaac
gtgttgcaggccgagttgctgcatcgttcacgtcagcaggaaaaaccggatgccgatctg
gagctggcgttgatggtcaccatcgccggtgttgcagcaggtatgcgtaatacgggctaa

DBGET integrated database retrieval system