KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_4160Help
Entry
PC1_4160          CDS       T00934                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PC1_4160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACT15174
UniProt: C6DII0
LinkDB All DBs
Position
4694463..4695089
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHSKHHQAYVNNANAALESLPELAKLSVEELIAQ
LDKVPAEKKAALRNNAGGHANHSLFWKGLKVGTTLTGDLKAAIERDFGSVDAFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGYPIVGLDVWEHAYYLKFQ
NRRPDYAKAFWNVVNWDEAAARFASAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcgctgccttatgcttatgacgcactggaaccgcatttcgac
aaagagacgatggaaattcaccattccaaacaccatcaggcttacgtcaataatgctaat
gccgcgctggaatctctgcctgagctggctaaattgtctgttgaagaactgatcgcccaa
ctggataaagtccctgctgagaaaaaagcagcactgcgtaacaacgcaggtggccatgct
aaccacagcctgttctggaaaggcctgaaagtaggcacgacgctgactggcgacctgaaa
gccgccatcgaacgtgatttcggcagcgttgatgcatttaaagagaaatttgagcaagca
gcagcaacccgttttggttctggctgggcctggctggtgctgaaagacgacggcaaactg
gctgtagtctctactgcaaaccaagacagcccgctgatgggtgaagcaatttctggtact
tctggctacccaatcgtcggtctggacgtatgggaacacgcttactacctgaaattccaa
aaccgtcgcccagattacgcgaaagcattctggaacgtggtgaactgggacgaagcagca
gctcgtttcgccagcgcgaaaaaataa

DBGET integrated database retrieval system