KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_4202Help
Entry
PC1_4202          CDS       T00934                                 

Definition
(GenBank) universal stress protein UspB
  KO
K06144  universal stress protein B
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
KEGG Orthology (KO) [BR:pct00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pct02000]
    PC1_4202
Transporters [BR:pct02000]
 Other transporters
  Others
   PC1_4202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UspB
Motif
Other DBs
NCBI-ProteinID: ACT15216
UniProt: C6DJB7
LinkDB All DBs
Position
4746570..4746905
Genome map
AA seq 111 aa AA seqDB search
MISTFALFWALCIVCIINMARYYSSLRVLLLVLRDCDPLLYQYVDGGGFFTSHGQPSKQI
RLVGYIYAQRYLDHHDPEFIRRCERVRGQFLLTTALCGLIVISLIAMMIWY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgattagtacatttgcgcttttctgggctttatgtatcgtctgcatcattaatatggcg
agatactactcttcattgcgcgtgttactgctggttttgcgtgactgtgacccgctactt
taccaatacgttgacggagggggattctttacctcgcacggccagccaagcaagcaaatc
aggctggtaggctatatctacgcacaacgctatcttgatcatcacgaccctgagtttatt
cgccgctgcgagcgggtgcggggacaattcctgctcacgaccgccctgtgtggccttatt
gtcatcagcctgattgccatgatgatatggtattaa

DBGET integrated database retrieval system