KEGG   Candidatus Protochlamydia amoebophila: pc1273Help
Entry
pc1273            CDS       T00172                                 

Definition
(GenBank) hypothetical protein
Organism
pcu  Candidatus Protochlamydia amoebophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAD
Motif
Other DBs
NCBI-ProteinID: CAF23997
UniProt: Q6MBQ2
LinkDB All DBs
Position
complement(1524407..1525651)
Genome map
AA seq 414 aa AA seqDB search
METKSVGTFSTGEIEEIRILFEALKKTETKNREFINKIETVSSQVLLVTDKERSFQKDNS
DLTQKITALNQDNGKFKKTMLNHEQQISLLQKEFQKVQETLNGKVRQIAGIQRTLEKYEK
EKQELSKTSARLVNENAKFVNERDSLNTILGDLLKEKYELENQEKAHQEKVNRLKQDLNE
AQGLYFESKRSNNLKISEKIRLIINEKLKCEKLTQKSILIRKGRDQAKQKLAEGQAKHTQ
IGQNLLKERAGYIQTSQSLAQVKAEHAQTTRKLNQTQHELTQSQQTVSRQRINYQELENK
LGETDNRLISQEELQKLSNKIQSKEEVKELITRLSLINLNDLSKLQNWVKDCTAAFGFND
DEQRNLESNLSNLLSKPGFFTWPKMLREGVMFSLEGTSIHYLPLLISLLSKLIK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaatccgtgggtactttttcaacaggagaaatagaagaaataaggatttta
tttgaagctctaaaaaaaacagaaacaaaaaatagagaattcataaataaaatcgaaaca
gtttccagccaagttttactagttactgacaaagaacgtagttttcagaaagataatagt
gacctcactcaaaaaatcacggctcttaatcaggataatggtaaatttaaaaagacaatg
cttaaccatgagcaacaaataagtttgcttcaaaaagaatttcaaaaagttcaagaaacg
ttaaatggaaaagttaggcaaatagcaggtattcaaagaacactcgaaaaatatgaaaaa
gaaaaacaagagctttctaagacaagtgcaaggcttgtcaatgaaaatgccaaatttgtc
aatgaaagagatagcttaaatacgatattaggagatttactcaaggaaaagtatgaactt
gaaaaccaagagaaagcacatcaagaaaaagtaaatagactgaagcaagatttaaatgaa
gcacaaggtctttattttgagtcgaaaagaagtaataatttgaaaatttctgaaaaaata
aggttaattattaatgaaaagcttaaatgcgaaaaacttactcaaaaaagcattttaatt
agaaaaggtcgcgatcaagcaaaacagaagttggctgaagggcaagcaaaacatacgcaa
atagggcagaacttgcttaaagaacgagcaggatatatacaaacaagccagagccttgct
caagtaaaagcagagcatgcccaaacaacaagaaagttaaaccaaactcaacatgagcta
actcaatctcagcaaacagtatcaagacaaagaataaattatcaagagcttgaaaataaa
ctaggggagactgacaatagacttatatctcaagaagaattacaaaaattgagcaacaaa
attcaatccaaagaagaagtaaaagagcttattacgcgtcttagcttaataaatttaaat
gatttaagtaaacttcaaaattgggttaaagattgtacggcagcgtttgggtttaatgac
gacgagcagcgtaatttagaaagtaatttatcaaatctattgagcaaacctggatttttt
acatggccaaaaatgttaagagaaggagttatgttttctttagaaggaacctcgattcat
tatttgcccttgctaattagtttgttatctaagttaattaaatag

DBGET integrated database retrieval system