KEGG   Pectobacterium carotovorum subsp. odoriferum: BCS7_06475Help
Entry
BCS7_06475        CDS       T03424                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pcv  Pectobacterium carotovorum subsp. odoriferum
Pathway
pcv00010  Glycolysis / Gluconeogenesis
pcv00260  Glycine, serine and threonine metabolism
pcv00680  Methane metabolism
pcv01100  Metabolic pathways
pcv01110  Biosynthesis of secondary metabolites
pcv01120  Microbial metabolism in diverse environments
pcv01130  Biosynthesis of antibiotics
pcv01200  Carbon metabolism
pcv01230  Biosynthesis of amino acids
Module
pcv_M00002  Glycolysis, core module involving three-carbon compounds
pcv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCS7_06475 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    BCS7_06475 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCS7_06475 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcv04131]
    BCS7_06475 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcv04147]
    BCS7_06475 (gpmA)
Enzymes [BR:pcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCS7_06475 (gpmA)
Membrane trafficking [BR:pcv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCS7_06475 (gpmA)
Exosome [BR:pcv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCS7_06475 (gpmA)
  Exosomal proteins of melanoma cells
   BCS7_06475 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIU87842
LinkDB All DBs
Position
complement(1487999..1488751)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRSEAKAAGQLLKDEGFAFDFAYTSVL
KRAIHTLWNILDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTRDDERFPGHDPRYAALSDKELPLTESLALTIERVVPYWNETILPRVKSGERVI
VAAHGNSLRALVKYLDNLGEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtaagacacggtgagagccagtggaacaacgaaaac
cgcttcacaggctggtacgatgtcgatctatctgacaaaggccgttcagaagccaaagcc
gcaggtcagctgctgaaagacgaaggttttgcctttgatttcgcgtatacctccgtgctg
aaacgtgccattcatacactgtggaatatactggacgagctggatcaagcctggttgcca
gttgagaaatcctggaaactgaatgagcgccactacggtgcactgcaaggtctgaacaaa
gccgaaaccgctgagaaatacggtgacgagcaggttaaacaatggcgtcgtggttttgcg
attacgcctccagagttgacgcgtgatgacgaacgtttcccaggtcacgacccgcgttac
gctgctctgagcgacaaagagctgccgctgactgaaagcctagcgctgaccatcgaacgt
gttgtgccttactggaacgaaactatcctgccacgcgtcaaaagcggtgagcgtgtgatc
gttgcggctcacggtaactcactgcgtgcgctggtaaaatacctggacaacctaggcgaa
gacgaaattctggaactgaatatcccaactggcgtgccgttggtttatgaattcgacgag
aacttcaagcctatcaaacgttactacctgggcaacgcagacgaaatcgctgcaaaagct
gccgcagtagcgaatcagggtaaagcgaaataa

DBGET integrated database retrieval system