KEGG   Pectobacterium odoriferum: BCS7_10345Help
Entry
BCS7_10345        CDS       T03424                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
pcv  Pectobacterium odoriferum
Pathway
pcv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pcv01100  Metabolic pathways
pcv01110  Biosynthesis of secondary metabolites
pcv01130  Biosynthesis of antibiotics
pcv01230  Biosynthesis of amino acids
pcv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pcv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCS7_10345
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BCS7_10345
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BCS7_10345
Enzymes [BR:pcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BCS7_10345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N Lipase_GDSL_3
Motif
Other DBs
NCBI-ProteinID: AIU88496
UniProt: A0A094SV58
LinkDB All DBs
Position
complement(2329412..2330974)
Genome map
AA seq 520 aa AA seqDB search
MQTTQPKLELLRTEAVYRNDPSAIFHQLCGARPATLLLESAEIDSKENLKSLLIVDSALR
ITALGQHVSIQALTANGASLLPLLDAALPVEITNQPRPNGRELTFPLADAMQDEDARLRS
LSVFDALRQILTLVTCPTDEREAMFLGGLFAYDLVAGFEELPALSQQQRCPDFCFYLAET
LLVLDHQKRVTALQASLFTPNQSEKQRLQQRLEQLQLQLTQPAPALPRQSIEDMTLSCNQ
SDEAFGDVVSQMQEAIRIGEIFQVVPSRRFSLPCPSPLAAYQTLKDSNPSPYMFYMQDQD
FTLFGASPESSLKYDADSRQIEIYPIAGTRPRGRRADGSLDRDLDSRIELEMRTDHKELA
EHLMLVDLARNDLARICQPGSRYVADLTKVDRYSFVMHLVSRVVGTLREDLDVLHAYRAC
MNMGTLSGAPKVRAMQLIAESEKTRRGSYGGAVGYFTAHGDLDTCIVIRSAYVEDGIATV
QAGAGVVLDSNPQAEADETRNKARAVLRAIASAHHAKEIF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaacacaacctaaactggaactgctgcgtaccgaggccgtttatcgtaacgac
cccagtgccatcttccatcagctctgcggtgccagacctgcaacgttgctgttagagtcg
gctgaaatcgacagcaaggaaaacctgaaaagcctgttgatcgtagatagtgcgctgcgc
atcaccgcactgggccagcacgtttccattcaggcactcacagcaaacggcgccagcctt
ttgccacttctggatgccgcgctgccagtggagattaccaatcagccgcgcccgaatggc
cgtgagctcactttcccgctggcagacgcgatgcaggacgaagatgctcgcctgcgctcg
ctatctgtgtttgatgccttacgccagattctgacgcttgtcacctgcccgacagacgag
cgggaagccatgttcctcggcggcctgttcgcctacgatttggtcgctggttttgaagaa
ctgccagcgctgagccagcagcagcgttgcccggatttttgcttctatctggcagaaacg
ctgctggtgcttgaccaccaaaaacgtgtgaccgctctgcaagccagcctgtttacgccg
aaccagagcgaaaagcagcgtctacagcagcgtctggaacagttgcaacttcagctcact
cagccagcgccggcgctgccgcgtcagtccatcgaagacatgacgctgagctgcaaccag
agcgatgaggctttcggtgacgtcgtcagccagatgcaagaagccatccgcatcggtgaa
atttttcaggtcgtgccgtcacgtcgtttctctctgccgtgtccttcaccgctagcagcc
taccaaacactgaaggatagcaatcccagtccttacatgttttacatgcaggatcaggat
ttcacactgttcggcgcctcgccggaaagctcgctgaaatacgatgccgacagccgccaa
atcgaaatctaccccattgccggtacccgcccgcgcggtcgccgtgccgatggctcactg
gatcgcgatctcgatagccgtattgagttggaaatgcgtaccgaccataaagagctggct
gagcatctgatgctggtagatttagcccgtaacgatctggctcgtatctgtcagccaggc
agccgttacgttgctgatctgactaaagttgaccgctattcctttgtgatgcatctggtc
tcccgcgtggtgggcacactgcgtgaagatttagatgtgctgcacgcctatcgcgcctgc
atgaatatgggcacgctgagcggcgcaccgaaagtcagggcaatgcagctgattgccgaa
agtgagaaaacccggcgcggcagctacggcggcgccgtcggctacttcaccgcgcacggc
gatctggacacctgcatcgtcattcgttccgcctatgtcgaagacggtattgccaccgtt
caggctggtgcgggcgtggttctggattctaaccctcaggccgaagctgacgaaacacgc
aataaagcccgggccgtactacgagctattgccagtgcgcaccatgcaaaggagattttc
tga

DBGET integrated database retrieval system