KEGG   Pectobacterium carotovorum subsp. odoriferum: BCS7_10725Help
Entry
BCS7_10725        CDS       T03424                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pcv  Pectobacterium carotovorum subsp. odoriferum
Brite
Enzymes [BR:pcv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BCS7_10725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIU88565
UniProt: A0A094S0K7
LinkDB All DBs
Position
2417716..2418240
Genome map
AA seq 174 aa AA seqDB search
MKLKALILTGVFFSCSTFAASTTVTLNEALPTGTGGSIGEVSITETPYGLLFTPSLKGLK
AGIHGFHVHENASCEPAEQDGKPVPALAAGGHLDPKKTGKHLGPYNDQGHLGDLPGLVMN
ADGTSTYPLLAPRIKSLSEVKNHALMVHVDGDNYADTPAKLGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaggcacttatcctgacaggcgtgttcttttcctgttccaccttcgcggca
agcaccacggtgacgctgaatgaagcgctgccaacgggcacaggtggaagtatcggtgag
gtatccattacggaaacgccgtacggcctgcttttcacgccgagtctgaaaggactgaaa
gcgggtattcacgggttccacgtgcatgaaaatgccagttgtgaacccgccgaacaagac
ggaaaaccagttcccgccctggcggcgggcggccacctcgatccgaaaaaaaccggtaaa
caccttggcccttataacgatcagggacatttgggcgatctgcccggtctggtcatgaat
gcggacggcacgtcaacttatccactgttggctccacggataaaatcgctgtctgaggta
aaaaatcatgcgttgatggttcacgtcgacggggataactatgctgacacgccagcaaaa
ctgggcggtggcggagccaggatggcgtgcggagtgattaagtaa

DBGET integrated database retrieval system