KEGG   Pectobacterium carotovorum subsp. odoriferum: BCS7_19440Help
Entry
BCS7_19440        CDS       T03424                                 

Gene name
hslO
Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
pcv  Pectobacterium carotovorum subsp. odoriferum
Brite
KEGG Orthology (KO) [BR:pcv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pcv03110]
    BCS7_19440 (hslO)
Chaperones and folding catalysts [BR:pcv03110]
 Heat shock proteins
  HSP33
   BCS7_19440 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 zf-RING_7
Motif
Other DBs
NCBI-ProteinID: AIU90002
UniProt: A0A094RYU2
LinkDB All DBs
Position
4398718..4399587
Genome map
AA seq 289 aa AA seqDB search
MVHDQLHRYLFENYAVRGELVTVNETYQRILTNHDYPAAVQTLLGEMLVATSLLTATLKF
SGDITVQLQGDGPLKLAVINGNHQQQMRGVARLQGDITPGSSLKEMVGNGYLVITITPTD
GERYQGVVGLEGETVAECLESYFQQSEQLPTRLFIRTGQHEGKQAAAGMLLQVLPAQDTD
RNDFDHLAQLTTTVKADELFTLPATEVLYRLYHQEEVTVYEPQDVEFRCHCSRDRCADAL
MTLSDQDVNEMIEQDGEIDMHCDYCGTHYLFNSLDIRAIRQDSSGNLLH
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgaccaactacatcgttatctgtttgaaaattatgccgttcgtggcgagttg
gtgacagttaacgagacgtatcaacgtattttgaccaaccacgactacccagcggcggta
caaacgctgctaggcgaaatgctggttgccaccagcctgttgacggccacgctgaaattc
agcggcgatattaccgttcagcttcagggcgatggcccactgaaactggcggtgattaac
ggtaatcaccagcagcagatgcgcggcgttgcccgtctgcaaggggatatcaccccaggg
agttcgctgaaagagatggttggcaatggctatctggtcattaccattacgccgactgac
ggcgagcgttatcaaggcgtcgtcggtttagaaggtgaaaccgttgccgaatgtctggag
agctatttccagcagtccgagcagttgccaacacggttatttatccgtaccggacagcac
gagggcaagcaggccgccgctggcatgctgctacaagtattgcccgcccaggataccgat
cgtaatgattttgatcatctggcccagctcaccacgacggtcaaagctgacgagctgttt
accctacccgccaccgaggtgctgtaccgcctttaccatcaggaagaggtaaccgtatat
gagccgcaggacgtcgagttccgctgtcactgttcgcgcgatcgttgcgcagatgcatta
atgacgctgtccgatcaggacgtgaatgagatgatcgagcaagacggtgaaatcgatatg
cactgtgattattgcggtacgcactacctgtttaattcgctggacatccgcgcgatccgg
caagattcatcagggaatctgttgcattaa

DBGET integrated database retrieval system