KEGG   Pectobacterium carotovorum subsp. odoriferum: BCS7_19680Help
Entry
BCS7_19680        CDS       T03424                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pcv  Pectobacterium carotovorum subsp. odoriferum
Pathway
pcv00564  Glycerophospholipid metabolism
pcv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCS7_19680 (glpD)
Enzymes [BR:pcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BCS7_19680 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N FAD_binding_3 PAP_PilO FAD_oxidored GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AIU90043
LinkDB All DBs
Position
4455365..4456867
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALSERETLLKMAPHIIFPMRFRLPHQPHLRPAWMIRIGLFMYDNIGKRVSLPAS
KGLKFGADSVLKPELKQGFEYSDCWVDDARLVVLNAQEVTKRGGEVRTRTKVTRARREQG
VWIVDAVDSLTGETFTWRAKGLVNATGPWVKEFFDDGLQLKSPYGIRLIKGSHIVVPKVH
NQPQAYILQNKDHRIVFVIPWQDDYSIIGTTDVEYKGNPHDVKIDDNEVGYLLDVYNDHF
KQQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVDDDNGQAPLLSVFGGKLTTYRK
LAEHALDKLHKYYPQAGKAWTKGAVLPGGDIAGTRDDYAAALRRRFNLPESLTRRYSRTY
GSNSELILANVKGLSDLGEDFGHDLYEAELRYLVEKEWAVALDDVIWRRTKLGMRFDDAQ
KQRISDWLASYRKQQMAKAN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctcatcgttatcggcggcggaattaacggtgcaggcatcgccgca
gatgcggctgggcgaggactatcagtcctgttgttggaagcgcaggatcttgcctgtgcc
acgtcctctgccagttccaagctgattcacggcggcctgcgttaccttgagcactatgaa
tttcgtttggtcagcgaagcgctgtctgagcgcgaaacactgctgaaaatggctccgcac
attattttccccatgcgctttcgtttgccccatcagccgcacctgcgtccggcctggatg
attcgtatcggcctgttcatgtatgacaacattggcaaacgcgtcagcctgcctgccagt
aaaggcctgaaattcggtgctgattcggtgcttaagcccgagctaaaacagggctttgaa
tactctgactgctgggtggacgatgcgcgtctggtggtgttaaacgcgcaggaagtgaca
aaacgcggaggtgaagtccgtacccgcaccaaagtcacccgcgctcgccgtgagcaaggc
gtgtggattgtcgatgcagttgactcactgacgggcgaaaccttcacctggcgcgccaaa
ggtctggtgaacgccacgggtccgtgggtgaaagaattctttgatgacggcctacagctg
aaatcgccttacggcatccgtttgatcaaaggcagccacatcgtggtgccaaaagtccat
aaccagccacaggcgtacattctgcaaaacaaagatcaccgtattgtgttcgtgatcccg
tggcaggatgactactcaatcatcggcacgaccgacgtggagtacaaaggcaatccgcac
gatgtgaagatcgatgataacgaagtcggctacctgttagatgtgtataacgaccatttc
aaacagcaacttacgcgtgacgatatcgtctggacttactctggcgtgcgtccactgtgt
gatgacgagtccgattctccgcaggcgattacccgtgactacacgctgtcagtcgatgat
gataacggtcaggctccactgctttccgtatttggcggcaagctgacgacataccgtaag
ctggcagaacacgcgctggataagctgcacaaatactacccgcaagcgggtaaagcctgg
acgaaaggtgcagtattgccgggtggcgatattgctggcacgcgtgatgactacgccgcc
gcgctgcgtcgccgcttcaatctgcctgaatcactgacgcgccgttacagccgcacctac
ggttcaaacagcgaactgattctggcaaacgtgaaaggcctcagcgacctgggtgaagat
ttcggtcatgacctgtacgaagcggaactgcgctatctggtcgagaaagaatgggccgtc
gcgttagacgacgttatctggcgtcgcaccaaactgggtatgcgctttgatgacgcgcag
aaacagcgcatcagcgactggttagcaagctaccgcaaacagcagatggcaaaagcgaat
taa

DBGET integrated database retrieval system