KEGG   Phascolarctos cinereus (koala): 110192171
Entry
110192171         CDS       T05867                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00220  Arginine biosynthesis
pcw00330  Arginine and proline metabolism
pcw01100  Metabolic pathways
pcw04020  Calcium signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04146  Peroxisome
pcw04371  Apelin signaling pathway
pcw04926  Relaxin signaling pathway
pcw05010  Alzheimer disease
pcw05014  Amyotrophic lateral sclerosis
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05133  Pertussis
pcw05140  Leishmaniasis
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05152  Tuberculosis
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110192171 (NOS2)
   00330 Arginine and proline metabolism
    110192171 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110192171 (NOS2)
   04066 HIF-1 signaling pathway
    110192171 (NOS2)
   04020 Calcium signaling pathway
    110192171 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110192171 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110192171 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110192171 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110192171 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110192171 (NOS2)
   05014 Amyotrophic lateral sclerosis
    110192171 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110192171 (NOS2)
   05152 Tuberculosis
    110192171 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110192171 (NOS2)
   05145 Toxoplasmosis
    110192171 (NOS2)
   05140 Leishmaniasis
    110192171 (NOS2)
   05142 Chagas disease
    110192171 (NOS2)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     110192171 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 110192171
NCBI-ProteinID: XP_020818836
LinkDB
Position
Unknown
AA seq 1153 aa
MREGVSSACAMPRMFLLIKRIFGSHPVCCPNGSSPLTEDDVKPHTLSKPWNEQRQSAVVE
TKKTPEPQVKGTHALSGCPRHVRIKNWGNGMTFQDTLHHKAKLAIDCQSKTCRGSIMTPK
SMTRGTRDSPIPPGELLPQAIDFINQYYSSFKEAKIEQHLARVEAVTKEIETTGTYQLTE
DELIYATKQAWRNAPRCIGRIQWSNLQVFDARNCTTAKEMFEHICQHIRYATNNGNIRSA
ITIFPQRSDGKHDFRVWNAQLLRYAGYQMPDGSIVGDAASIEFTQLCINLGWVPKYGRFD
ILPLVLQANGQDPEVFDIPKDLVLEVAIEHPKYEWFKELDLKWYALPAVANMLLEVGGLE
FPGSPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLSSLWKDRAVIEINVAVL
HSFQKQNVTIMDHHSAAESFMKYMQNEHKSRGGCPADWVWLVPPISGSITPVFHQEMLNY
ILSPFYYYQVEAWKTHVWHDEKKRPKKREIKLKVVIRAVFFVSVLMCKTMAARIKATVLF
ATETGKSETLARDLGELFSCAFNTKILCMDEYKVSDLEKEKLLLVVTSTFGNGDSPGNGE
KLKKSLFLLKELKNKFRYAIFGLGSSMYPQFCAFAHDIDQKFLQLGASQLAPTGEGDELS
GQDEAYRSWALHTFKVACETFDIQARQTIQIPKLYTTNETWNPENYRLVQDPQPLDLNKA
LSSMHAKNVFSMRLKSRQNLQSLKSSRATLLVKLSCEGNENLNYVPGEHLGVFPGNQPTL
VQGIIDRVKDGPSPHQSICLETRSENGDYWISDKKLPPCSLSQALTYFLDVTTPPTQLLL
RKLAQLTTSEEEKRRLEVLCQTSEYNKWKFNNSPTFLEVLEEFPSIQISATFLLTQLPLL
KPRYYSISSSRDLTPKEIHLTVAVVTYRTRNGQGPLHHGVCSTWLSNLNLQETVPCFVRS
ASGFQLPENPSHPCILVGPGTGIAPFRSFWQQRLVDREKKGIKTASMTLVFGCRHPDMDH
LYREEMKEMTLKGVLRDVYTAYSRQPGQSKVYVQDILRQSLADEVIRVLHEDKGHLYVCG
DVRMARDVAQTLKDLFANRLKMNEEQTENYFFQLKSQKRYHEDIFGAVFPYEVKTDPAAS
KPEEAKIPEAKLS
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgagggaaggggtcagctctgcctgtgccatgccaaggatgttcctgctgattaaaagg
atctttgggagccatcctgtgtgctgtccaaatggatccagtccactgacagaggatgat
gttaagcctcacactctgagcaaaccctggaatgagcaacgacaatcagctgtggtggag
acaaagaagacgcctgagccccaagtcaaggggacccatgctctatcaggctgtccaagg
catgtgaggattaaaaactggggcaatggaatgacattccaagacactctacaccacaaa
gccaaattggctattgattgccagtcgaaaacttgccgggggtcaatcatgacccctaag
agtatgacaagagggactagagacagtccgatccctccgggagagcttctgcctcaagcc
atcgacttcatcaaccagtattacagctccttcaaagaggcaaaaatagagcagcatttg
gccagagtggaagcagtaacaaaagagatagaaacaacaggaacctaccagctgacggaa
gatgagctcatttatgcaaccaagcaggcctggagaaatgcccctcggtgcattgggagg
atccagtggtcaaacctgcaggtgtttgatgctcgaaactgcacaacagccaaggagatg
tttgagcacatctgtcagcatatccgctatgcaaccaacaatggaaatatcaggtcagcc
attaccatctttccccagaggagtgatgggaaacatgacttccgggtctggaatgctcag
ctccttcgatatgctggctaccagatgccagatggctccatcgtaggagatgccgccagc
attgagttcacccagctgtgcataaacttgggatgggtgcccaaatatggccgctttgat
atcttgcctctcgtgttacaagccaatggccaggatccagaagtctttgacatcccaaaa
gaccttgtccttgaggtggctatagaacatcccaagtatgagtggttcaaggaactggat
ctgaagtggtatgctctgcctgccgtggccaacatgctcctggaagtgggtggcctagag
ttccccgggagcccatttaatggctggtacatggggactgagatcggtgtccgagatttc
tgtgatgtccagaggtacaatatcctagaggaagttggaaggagaatgggtctggaaacc
cacaagttgtcttctctctggaaggacagggcagtgattgagatcaatgtggctgtgcta
cacagtttccaaaaacaaaatgtcaccatcatggatcaccactccgcagcggaatccttc
atgaaatacatgcagaatgaacacaagtctcgaggcggctgcccggcagattgggtctgg
ctggtcccaccgatctctggcagcatcacccccgtgtttcatcaggagatgctaaactac
attctttctcctttctactactaccaggtggaggcctggaaaacccatgtctggcatgat
gagaagaagaggcccaagaaaagagagatcaaattaaaggtcgtgatcagagcagtgttc
tttgtctctgtcctgatgtgcaagaccatggcagctcggatcaaagccactgtcctcttt
gcgacagagacgggcaaatcagaaactctggccagggatttgggagagttgttcagctgt
gctttcaataccaagattctctgcatggacgaatacaaagtgagtgacttagaaaaagag
aagctacttctggtggttaccagcacttttggaaatggggattctcctgggaatggtgag
aaactgaagaagtccctgtttctcctgaaagagctaaaaaataaattcagatatgctata
tttggtcttggctccagcatgtacccccaattctgtgccttcgcccatgatatcgatcag
aagtttttgcagctaggggcctctcaacttgcacccactggagaaggagatgagctcagc
ggccaagatgaggcctaccgcagctgggcactgcataccttcaaggtggcctgtgagacc
tttgacatccaagccaggcaaacaattcagatccccaagttgtatactaccaatgaaacc
tggaaccctgaaaattatcgccttgtacaggatccccagcccctggacctcaacaaagcc
cttagcagtatgcacgccaagaatgtgttttccatgcggctcaaatcgagacagaatttg
cagagtctcaaatccagccgagcaaccctcctcgttaagctttcctgtgaaggaaatgag
aatctgaattatgtaccaggagagcatcttggggtttttcctggcaaccagcccacccta
gttcagggcattatagaccgagttaaggatggcccatcacctcaccaatccatctgtcta
gaaacccgcagtgagaatggtgattactggataagtgataagaagcttcccccctgctcg
ctcagccaggccctgacgtatttcctggatgtcactacccccccaacccagctgctgctc
cgaaagttggctcaactgaccacctcagaggaagagaagaggcggctggaggtgctgtgc
cagacctctgaatacaataaatggaaatttaacaacagccccacattcctggaggtgctg
gaagagtttccctccatccagatctcagctactttcctgctcacgcaattgcccctgctg
aagcctcgctactattccataagctcatctcgggacctcacccccaaggagatccacctg
accgtggctgtggtcacttaccggaccagaaatggtcagggccccctccaccacggggtc
tgcagcacatggctcagcaacctgaacctccaggagactgtgccctgctttgtacgcagt
gccagcggcttccaactgccagagaaccccagccacccctgcattctggtggggccaggt
accgggattgcccccttcagaagtttctggcagcagcgactggtggacagagagaagaaa
ggtatcaagaccgccagcatgaccttggtgttcggatgccgacacccagacatggaccac
ctgtatcgagaggagatgaaggagatgacactgaagggggtgctccgggatgtctacaca
gcctactcccgccagcctggccagtccaaagtctatgttcaggatatcctgaggcagagc
ttggcagatgaggtgattcgggtactgcatgaggacaaagggcacctgtacgtctgtggg
gatgtgaggatggcccgggatgtggcccagactctgaaggatctctttgccaacagactg
aagatgaatgaagagcagactgagaactatttcttccaactcaagagccaaaagcgatac
catgaagacatctttggggctgtctttccctatgaggtgaaaactgacccagcagcatca
aaacctgaggaggccaagatccctgaggcaaagctcagctag

DBGET integrated database retrieval system