KEGG   Phascolarctos cinereus (koala): 110192193
Entry
110192193         CDS       T05867                                 

Gene name
TRAF4
Definition
(RefSeq) TNF receptor-associated factor 4 isoform X1
  KO
K09848  TNF receptor-associated factor 4
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04657  IL-17 signaling pathway
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    110192193 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110192193 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110192193 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-TRAF_2 MATH zf-C2HC_2 zf_C2HC_14
Other DBs
NCBI-GeneID: 110192193
NCBI-ProteinID: XP_020818865
UniProt: A0A6P5IA66
LinkDB
Position
Unknown
AA seq 602 aa
MQCPWGTSGKGWLRLPQAVRHTWVRALAQGLPQHFVTGWELPVTGSGYDIEAGAARWGLE
GIMNEGGEQIQAWGNLEVLAYILALGGRGIYFPGIDLSAPRDGGPEPFPRQQSHGSCSPL
LLPKPPHLPCFGGDLTLRVGLPGMTFALASQWLWVGECRSSPGEAALVLSACSLRSCRAN
EGVFKCPEDQLPLDYAKIYPDPELEVQVLSLVIRCIHSEEGCRWTGALRHLQVHLSSCGY
NVVSCPNRCSAKLSRRDLPTHLQHECPKRRLKCDFCGIDFTGEAYESHEGVCPQESVYCE
NKCGARMMRRLLGQHMITECPKRTQPCAYCSKEFVFDTIQNHQHQCPRYPVPCPNQCGMG
SIPREDLSSHLKENCSSAPVLCPFKDAGCKHRCPKLAMGRHMEDSVKPHLAMMCALVSRQ
RQELQELRRDVEELSVGCDGVLIWKIGGYGRRLQEAKARSNHECFSPAFYTHKYGYKLQV
SAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPTVTKPQHVTETF
HPDPHWKNFQKPGTWRGSVDESALGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPKKI
LS
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgcagtgcccctggggcacctctgggaaggggtggctaagacttccacaggctgtcagg
cacacatgggtccgtgccctagcgcagggtcttccacaacactttgttactgggtgggag
ttgccagttactgggagtgggtatgatatagaggctggcgcagcaaggtggggtttggaa
gggataatgaatgaaggtggagagcagattcaggcttgggggaacctcgaggtgttagcc
tatattttagctctcgggggaaggggcatatattttcctggcatagacctgagtgcaccc
agggatggaggaccagaaccgttccccagacagcagtctcatggctcatgcagtcccctc
ctacttcccaagcccccccacctcccctgttttgggggagatctgacactaagggtgggg
cttccaggaatgacctttgccctggcatcacaatggctgtgggtgggggagtgcaggagt
agccctggtgaggctgcccttgtactctcagcctgctccctgagaagttgtagagctaat
gaaggagtttttaaatgtcctgaggatcagctacctttggactatgctaagatctaccca
gacccagaactagaagtccaggtgttgagcctggtcatccgctgtatccacagtgaggag
ggctgtcgctggactggagccttacgccacctgcaggtccatctgagctcctgcggttat
aacgtggtctcttgccccaaccgctgtagtgccaagctgagccgtagggacctgcctacc
caccttcaacacgaatgccccaagaggaggctcaagtgtgacttctgtggcatcgacttc
acaggggaagcctatgagagccacgagggtgtctgcccacaggagagcgtgtactgtgag
aacaaatgcggggcccgaatgatgcggcggctgctggggcagcacatgataacggagtgt
cccaagcggacccagccttgtgcctactgcagcaaggagtttgtctttgataccatccag
aaccaccagcaccagtgcccccgctaccctgtaccgtgccccaaccagtgtggaatgggg
agcattcctcgagaggacttgtctagccacctgaaagaaaactgcagctcggcccctgtt
ctgtgcccgttcaaagatgctggctgcaaacaccggtgccccaagctggcgatgggccgt
cacatggaggacagcgtgaagccccacctggccatgatgtgtgccctggtgagtcggcag
cggcaggagctgcaggagcttcggagagacgtggaagagctgtcggtgggctgcgatgga
gtcctgatctggaagattggcggctacgggcgccgccttcaggaggccaaggctcgctcc
aaccacgaatgcttcagcccggccttctacacccacaagtacggttacaagctccaggta
tcggccttcctcaatggcaacggcagcggggaggggacccatctgtccctgtacatccga
gtgctgcccggcgcctttgacaacctgttggagtggcccttcgcccgacgggtcaccttc
tccctgctggaccagagtgacccgacagtcactaaaccccagcacgtcacggagaccttc
catccggacccccactggaagaacttccagaagccgggcacctggaggggctccgtggac
gagagcgccctgggttttggctaccccaagttcatctcccaccaggacatccgcaagcgc
aactacgtgcgtgatgatgctgtgttcatccgtgcttctgttgagctgcccaagaagatc
ctgagctga

KEGG   Phascolarctos cinereus (koala): 110192620
Entry
110192620         CDS       T05867                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04120  Ubiquitin mediated proteolysis
pcw04140  Autophagy - animal
pcw04144  Endocytosis
pcw04380  Osteoclast differentiation
pcw04620  Toll-like receptor signaling pathway
pcw04621  NOD-like receptor signaling pathway
pcw04622  RIG-I-like receptor signaling pathway
pcw04657  IL-17 signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw05132  Salmonella infection
pcw05133  Pertussis
pcw05135  Yersinia infection
pcw05140  Leishmaniasis
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110192620 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110192620 (TRAF6)
   04064 NF-kappa B signaling pathway
    110192620 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110192620 (TRAF6)
   04140 Autophagy - animal
    110192620 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110192620 (TRAF6)
   04621 NOD-like receptor signaling pathway
    110192620 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    110192620 (TRAF6)
   04657 IL-17 signaling pathway
    110192620 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110192620 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110192620 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110192620 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110192620 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110192620 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110192620 (TRAF6)
   05135 Yersinia infection
    110192620 (TRAF6)
   05133 Pertussis
    110192620 (TRAF6)
   05152 Tuberculosis
    110192620 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110192620 (TRAF6)
   05161 Hepatitis B
    110192620 (TRAF6)
   05160 Hepatitis C
    110192620 (TRAF6)
   05171 Coronavirus disease - COVID-19
    110192620 (TRAF6)
   05162 Measles
    110192620 (TRAF6)
   05168 Herpes simplex virus 1 infection
    110192620 (TRAF6)
   05169 Epstein-Barr virus infection
    110192620 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110192620 (TRAF6)
   05140 Leishmaniasis
    110192620 (TRAF6)
   05142 Chagas disease
    110192620 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110192620 (TRAF6)
   04121 Ubiquitin system [BR:pcw04121]
    110192620 (TRAF6)
Enzymes [BR:pcw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110192620 (TRAF6)
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110192620 (TRAF6)
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    110192620 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-C3HC4_4 SlyX zf-TRAF_2 TRAF6_Z2 zf-RING_5 Tropomyosin_1 zf-RING_11 DUF4455 U-box Spc29 zf-U1 DUF16 Med21 Tropomyosin CENP-F_leu_zip PspA_IM30 CENP-Q Sina DUF1664
Other DBs
NCBI-GeneID: 110192620
NCBI-ProteinID: XP_020819548
UniProt: A0A6P5IEG5
LinkDB
Position
Unknown
AA seq 540 aa
MSLVNCEDSCGANQPDSDCCTAMASACSTGAKEDSVNGSTIPGNLSSSLMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIVKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNEGCLLKMELRHLEDHQTHCEFALAECPQCHLSFRKYLLHNHMIM
ECPRRQVSCVNCAAPMPFEEKEFHDQNCPLATVFCEYCNTMLIREQMPNHYDIDCPIAPI
PCTFSTFGCREKMQRNHLARHLQEATLAHMRMMAQAIENISMAVFSSGHEAPPYDGNSVS
RTPSGCPQDVQNFQETIQQLESRLVIQDHQIRELTAKMETQSACVGDLKRTIRTLEDRIA
EMEAQQCNGIYIWKINNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQR
CANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRP
TIPRNPKGFGYVTFMHLQALRQRTFIKDDTLLVRCEVLTRLDMNSLRREGFQPRSTDVGV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgagtctggtaaactgtgaagacagctgtggtgccaaccaaccagacagcgactgttgt
actgccatggccagtgcctgtagcactggcgcaaaggaggatagtgtaaatgggagcacc
attcctgggaacctttccagctccttgatggaagagattcaaggctatgatgtggagttt
gatccaccccttgaaagcaaatatgagtgtcccatctgtctgatggcattacgagaagct
gtgcaaaccccgtgtggccatcggttctgcaaagcctgcattgtcaagtcaataagagat
gcaggtcacaaatgccctgttgacaatgaaatactgttggaaaatcaactatttcctgac
aactttgctaaacgggaaatcctctccctgacagtgaagtgtccaaatgaaggttgtctg
ctgaagatggaactgaggcatctagaggatcaccagacacattgtgagtttgcccttgca
gaatgcccacagtgccacctttcctttcggaaatatctccttcacaatcatatgatcatg
gagtgtccaaggcgacaggtgtcgtgtgtgaactgtgctgcaccaatgccatttgaagag
aaagagttccatgaccagaactgcccattggcaacagtcttctgtgaatactgcaacacc
atgctcatccgggaacagatgcctaatcactatgatatagattgcccaatagctccaatt
ccatgtactttcagtacatttgggtgtcgtgagaagatgcagaggaatcatttggctcgc
cacctgcaagaggctactctggcccacatgcgaatgatggcccaggccatcgagaacatc
agcatggcagttttcagttccgggcatgaggcccctccctacgatgggaactccgtatcc
cggacgccctcaggatgcccccaagacgttcagaacttccaggaaaccatccagcagttg
gagagtcgtcttgtaatacaagaccatcaaatccgagagctgactgctaagatggaaaca
cagagtgcttgtgtgggggacctcaaacggaccattcgaaccctggaggacagaattgct
gaaatggaggcacaacagtgcaatggcatttatatctggaagattaacaactttgggatg
cacttgaaatctcaagaagaagagaagcctgttgtcatccacagccctggattctatact
ggcaaacctggctacaaactctgcatgcgccttcacctgcagctgccaagtgctcagcgc
tgcgctaactatatttccctttttgtccacacgatgcagggtgagtatgacagccacctt
ccctggcccttccagggcacgatacgccttactattctcgatcagtctgaagcacctgtg
aggcagaatcacgaagagatcatggatgccaaaccagagctgcttgccttccagaggccc
accatcccccggaaccccaaaggttttggctatgtgactttcatgcacttgcaagccctt
aggcaaagaaccttcattaaagatgataccttacttgtgcgttgtgaggttttgacacgc
ctggacatgaatagcctaaggagggagggctttcagccacgtagtactgatgtaggggta
tag

KEGG   Phascolarctos cinereus (koala): 110197337
Entry
110197337         CDS       T05867                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04064  NF-kappa B signaling pathway
pcw04620  Toll-like receptor signaling pathway
pcw04621  NOD-like receptor signaling pathway
pcw04622  RIG-I-like receptor signaling pathway
pcw04657  IL-17 signaling pathway
pcw04668  TNF signaling pathway
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110197337 (TRAF3)
   04668 TNF signaling pathway
    110197337 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110197337 (TRAF3)
   04621 NOD-like receptor signaling pathway
    110197337 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    110197337 (TRAF3)
   04657 IL-17 signaling pathway
    110197337 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110197337 (TRAF3)
   05203 Viral carcinogenesis
    110197337 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110197337 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110197337 (TRAF3)
   05160 Hepatitis C
    110197337 (TRAF3)
   05171 Coronavirus disease - COVID-19
    110197337 (TRAF3)
   05164 Influenza A
    110197337 (TRAF3)
   05162 Measles
    110197337 (TRAF3)
   05168 Herpes simplex virus 1 infection
    110197337 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110197337 (TRAF3)
   05169 Epstein-Barr virus infection
    110197337 (TRAF3)
   05165 Human papillomavirus infection
    110197337 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF ATG16 Crescentin MPS2 Spc7 Sina Cast Tropomyosin_1 KxDL T3SSipB Spc29 FliJ BLOC1_2 DUF1664 SPATA24 GAS
Other DBs
NCBI-GeneID: 110197337
NCBI-ProteinID: XP_020826814
UniProt: A0A6P5IXF7
LinkDB
Position
Unknown
AA seq 567 aa
MDSSKKMDPPTPLQTVQQKANPDRGAGVSIYVPEQGGYKEKFVKPVEDKYKCEKCHLILC
NPKQTECGHRFCETCMHVLLSAPSPKCTACQENIIKDKVFKDNCCKREILALQIYCRNES
RGCTEQLTLGHLLVHLKSDCQFEELPCVRADCKEKILRKDLPGHVEKSCKYREATCQYCK
SQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELNAHLSECINAPSTCSFKRYGCTF
QGTNQQIKTHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKTAGQAARNTGLLETQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggattccagtaaaaagatggatccccctactccattgcaaactgtacaacaaaaggca
aatcccgatcgtggtgctggagtatcgatttatgtcccagaacaagggggatacaaggaa
aaatttgtgaagcctgtggaagacaaatataagtgtgaaaagtgtcacctcattttatgt
aaccctaagcagacagaatgtggtcaccgattctgtgaaacctgcatgcatgtcttgttg
agtgctccaagtccaaagtgtacagcatgtcaagaaaacatcattaaagataaggtattt
aaggataattgctgtaagagagaaattctggcccttcaaatatattgtagaaatgaaagc
agaggatgcacagaacaattaaccctgggacatttgctggtacatttaaaaagtgattgc
cagtttgaagaactgccatgtgttcgtgctgactgcaaagaaaaaatcctgcgaaaagat
ttaccaggccacgtagaaaagtcatgtaaataccgagaagcgacatgtcagtactgtaaa
agtcaagttcccatgataacgctgcagaaacatgaagatacagactgtccatgtgttgtt
gtctcatgcccacataaatgtagtgttcagacacttttgaggagtgagttgaatgcacat
ttgtcagaatgtattaatgccccaagtacctgtagttttaagcgttatggctgcactttt
cagggaacaaatcagcaaattaagacccatgaggccagctcagcagtgcaacatgttaat
ttactgaaagaatggagtaattctctagagaaaaaggtttccttgttacagaatgaaagt
gtagaaaaaaacaagagtatacaaagtttacacaatcagatatgtagctttgaaatagaa
attgaaagacaaaaagaaatgctccggaataatgaatccaaaatacttcatttacagcga
gtgatcgatagtcaggcagagaaactgaaagaactggataaagagatccgtcccttccga
caaaactgggaggaggctgacagcatgaaaagcagtgtggaatccctccagaaccgagtc
acggagctggagagcgtggacaagactgcaggacaagcagcacggaatacaggcttgctt
gagacacaattaagcagacatgaccagatgctaagtgttcatgatattcgactggctgac
atggacctccgattccaagtgctagaaaccgccagctacaatggggtgttaatctggaaa
attcgagattataaacgaaggaagcaggaagctgtcatggggaagaccttgtcactgtac
agccagcctttctatacgggctacttcggctataagatgtgtgctagagtttaccttaat
ggggatgggatgggaaaaggaactcacttgtctttgttttttgtcataatgcgtggagaa
tatgacgctttgcttccttggccctttaagcaaaaagtgactctcatgctaatggatcag
ggatcttctcgacgtcatttaggagatgctttcaaacctgacccaaacagcagtagtttc
aagaagcctaccggagagatgaacattgcatctggttgccctgtctttgtggcccaaact
gttctagaaaatgggacgtatattaaagatgatactatttttattaaagtcatagtggat
acgtcggatctgccagacccctga

KEGG   Phascolarctos cinereus (koala): 110205309
Entry
110205309         CDS       T05867                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04141  Protein processing in endoplasmic reticulum
pcw04210  Apoptosis
pcw04217  Necroptosis
pcw04380  Osteoclast differentiation
pcw04621  NOD-like receptor signaling pathway
pcw04622  RIG-I-like receptor signaling pathway
pcw04657  IL-17 signaling pathway
pcw04668  TNF signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04932  Non-alcoholic fatty liver disease
pcw05010  Alzheimer disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05017  Spinocerebellar ataxia
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05160  Hepatitis C
pcw05163  Human cytomegalovirus infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110205309 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110205309 (TRAF2)
   04064 NF-kappa B signaling pathway
    110205309 (TRAF2)
   04668 TNF signaling pathway
    110205309 (TRAF2)
   04071 Sphingolipid signaling pathway
    110205309 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110205309 (TRAF2)
   04217 Necroptosis
    110205309 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110205309 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    110205309 (TRAF2)
   04657 IL-17 signaling pathway
    110205309 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110205309 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110205309 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110205309 (TRAF2)
   05203 Viral carcinogenesis
    110205309 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110205309 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110205309 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    110205309 (TRAF2)
   05016 Huntington disease
    110205309 (TRAF2)
   05017 Spinocerebellar ataxia
    110205309 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    110205309 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110205309 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110205309 (TRAF2)
   05135 Yersinia infection
    110205309 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110205309 (TRAF2)
   05160 Hepatitis C
    110205309 (TRAF2)
   05168 Herpes simplex virus 1 infection
    110205309 (TRAF2)
   05163 Human cytomegalovirus infection
    110205309 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110205309 (TRAF2)
   05169 Epstein-Barr virus infection
    110205309 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcw03019]
    110205309 (TRAF2)
   04121 Ubiquitin system [BR:pcw04121]
    110205309 (TRAF2)
Enzymes [BR:pcw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110205309 (TRAF2)
Messenger RNA biogenesis [BR:pcw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110205309 (TRAF2)
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    110205309 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_4 zf-RING_6 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4_2 MATH Thioredoxin_3
Other DBs
NCBI-GeneID: 110205309
NCBI-ProteinID: XP_020837486
UniProt: A0A6P5JXR0
LinkDB
Position
Unknown
AA seq 633 aa
MDLDSGLLGHLPNSAANLLRDLGGVTAPLCSSVSPSVPMGRLFFNNRTFHSGEQRQLDTP
WSLISMGHGQNAVPASLTSGQDAGQVVSDTGPLNPALDQGLEVHLRVVAHMATANSTPPG
SLDLLQPGFSKDILGTKLEDKYLCSACKNILRRPFQAQCGHRYCSYCLTSIISTGPQNCA
ACIQEGIYEEGISILESSSAFPDNAARREVESLPAICVNDGCTWKGTIKEYESCHEGHCP
FMLIECPACKWMIKLGEKEHHSERECPKRSLNCRYCKVLFYYPDIKAHDEICPKFPLTCE
GCGKKKILREKFQDHVKACGKCKGPCKFHVVGCTEMVENEKQQDHEIQKVAEHLCMLLNF
VLEARHFHGDIGPLLGQGDMGGWGNNSLALGSEMSKSTELLERCETLERKTVTFENIVCV
LNREVERVSMTAEACSRQHRLDQEKIETLSTKVQQLERSIGLKDLAMADMEQKILEMEAS
TYDGIFIWKITDFARKRQEAMAGRSPAIFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLS
LFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNIASG
CPLFCPVSKMESKNSYVRDDAIFIKAIVDLTGL
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggaccttgattctgggcttctgggtcatcttcccaactctgctgccaatctcttgcgt
gaccttggtggagtcactgctcccctctgttcctcagtttctccctctgtaccaatgggg
agattatttttcaacaacaggacattccattcgggtgagcagagacagcttgatactccg
tggagcctgatatcaatgggacatgggcaaaatgcagtaccagcttctctgacttctggg
caagacgctggacaggtagtctctgatactggacccctcaatccagctctggatcagggt
ctagaagttcatttgagggttgtggctcacatggcaacagcaaattctactcctccaggc
tctttagatttgcttcagcctggattttcaaaggatatcctaggaacaaaactagaagat
aaatatctctgctctgcttgcaagaacattttgagaagaccatttcaagctcagtgtgga
catcgttactgttcttattgtctgaccagcatcataagcactgggcctcagaattgtgct
gcctgcattcaggagggaatatatgaagaaggcatttctattttagaaagtagttcggct
tttccagataatgctgctcgaagagaggtagaaagcctaccagctatctgtgtcaatgat
ggttgcacatggaaaggcactataaaagaatatgagagctgccatgaaggacactgccca
ttcatgctaatcgagtgcccagcatgtaagtggatgatcaaactgggtgagaaggagcat
cattctgagcgggaatgcccaaagagaagcctcaactgcagatactgcaaagttcttttc
tactatcctgatattaaggcccatgatgagatctgtcccaaatttcccttgacttgtgaa
ggctgtggtaagaagaaaattcttcgagaaaaatttcaggaccatgttaaggcctgtggc
aaatgcaaagggccttgcaaattccatgttgttggctgtactgaaatggtggaaaatgag
aaacagcaggatcatgaaattcagaaggtggctgaacacctctgcatgttgttaaacttt
gtccttgaggcgaggcacttccatggagatattggtccccttcttggccaaggtgacatg
gggggctggggaaacaactcattggccttagggtcagagatgtccaaatctacagagcta
ttggagagatgtgaaaccttggaaagaaaaacagtcacttttgagaacattgtctgtgtc
ttgaaccgagaggtggagagagtgtccatgacagccgaagcttgcagcaggcagcatcgc
ctagaccaggagaaaattgaaactctcagtaccaaggtccagcagctggaaaggagtata
ggattgaaagacctggcaatggctgacatggaacagaagatccttgagatggaagcttcc
acttatgatggaattttcatatggaagataacagactttgctaggaaacgccaggaagcc
atggctggccgctctcctgccatcttctctccagccttctacacgagcaaatatggctat
aagatgtgtttgagaatttatctgaatggggacggcactggacgtgggacccacctttcc
cttttctttgtcgtgatgaaaggaccaaatgatgcacttctacgttggccctttaaccaa
aaggtgacattaatgctgctagatcagaacaaccgggaacatgtgattgatgccttcagg
cctgatgtgacatcttcctctttccaaaggccagtcagtgatatgaacattgccagtggc
tgccccctcttctgtcctgtctccaaaatggagtcaaagaattcttatgtgcgcgatgac
gccattttcatcaaagccatcgttgatttgacgggtctctaa

KEGG   Phascolarctos cinereus (koala): 110211345
Entry
110211345         CDS       T05867                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor-associated factor 1 isoform X1
  KO
K03172  TNF receptor-associated factor 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04064  NF-kappa B signaling pathway
pcw04210  Apoptosis
pcw04668  TNF signaling pathway
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05203  Viral carcinogenesis
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110211345 (TRAF1)
   04668 TNF signaling pathway
    110211345 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110211345 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110211345 (TRAF1)
   05202 Transcriptional misregulation in cancer
    110211345 (TRAF1)
   05203 Viral carcinogenesis
    110211345 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110211345 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-C3HC4 zf-C3HC4_2
Other DBs
NCBI-GeneID: 110211345
NCBI-ProteinID: XP_020846233
UniProt: A0A6P5KKR7
LinkDB
Position
Unknown
AA seq 506 aa
MAENPTDSAPVGPCLTPDENEFPFGYPISICQKTPEPKYLCCGCHNVLKKAQQTLCGHRY
CAACLSWIVRISKNPICSRCKEENPQAVGDESFLSEEKAFIDAAINKEISELSVHCVISG
CGWTGLMKNFETHVCGGIFLKDHKQTVTEISTEEKDDLVPAEVQGRCSFADIGCSFKQGS
QEMVKEHEASSLRDHVRLLLQFVSQVKAQSDANREKRISGLSCTKPSMNPLEGNLSDLQL
QGAVEVNGDLEADCFHAASSDSEEELALQRFMKEKLLAELEEKLHVFENIVTVLNKEVEA
SHLAIAASVHQSGLTQDLILGLEQRVMDLQQTLAQKDLALTKLEQSLHLLEEASYDGVYL
WKITNFTRRCHESACGRMVSLFSPAFYTARYGYKLCLRIYLNGDGTGKGTHLSLFIVVMK
GEYDALLEWPFRNKVTFMLLDQNNREHVTDSFHPDPTSGSFQRPQGESNIASGRPMFFPL
NKLQSPKHAYVKEDTVFLKCVVETNS
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggcagagaaccctactgatagtgcccctgtgggcccctgcctcactcctgatgaaaat
gaattcccctttggataccctatcagtatctgccagaagacccctgagcccaaatacttg
tgctgtggttgccacaatgttctgaagaaggcccagcagaccctatgtggccaccgctac
tgtgctgcctgcctctcctggatagtgaggatcagcaagaaccctatatgttcaagatgc
aaggaagagaatccgcaggctgtgggagatgaaagtttcttatcggaagagaaggctttc
attgatgctgccattaataaggagatctctgagctaagtgtgcattgcgtgatttctggg
tgcggctggactggcctcatgaagaattttgagacacatgtatgtggaggaatcttcttg
aaggaccacaagcagaccgtgacggagatcagtacagaagagaaggatgatttggtgcca
gctgaggtccagggtagatgctcctttgcagacattggctgttccttcaagcagggtagc
caggaaatggtgaaggagcatgaggcttcctcactgagggaccatgtaaggctgctgtta
cagtttgtgagccaagtgaaggcccagtcagatgccaacagagagaaaaggatatcaggc
ctcagttgcaccaagccaagtatgaatcccctggagggaaacctgtctgacctacaatta
caaggagctgtggaggtcaatggtgacttggaggctgactgctttcatgctgcctcctct
gactctgaggaggagctggcgcttcagaggttcatgaaggagaagctgcttgctgagctg
gaagagaagctgcatgtgtttgagaatattgtgactgtcctgaacaaggaggtggaggcc
tcccacctggccattgctgcctccgtgcaccagagtggactgacccaggacctcatcctg
ggcttagagcagcgggtcatggatttgcaacagaccctggcccagaaagaccttgccctg
accaagttggagcagagcctccatctcctggaggaggcttcctatgatggcgtctaccta
tggaaaatcaccaacttcaccaggagatgtcatgagtctgcatgtggaaggatggtcagt
ctgttctcaccagctttttacactgcccgctatggctataaattatgccttcggatctac
ctgaatggagatgggacaggaaaaggcacacacctttcactctttattgtggtcatgaaa
ggggaatatgatgctctcctggagtggcctttccggaataaggtcacattcatgttgctg
gaccagaacaacagagaacatgtcactgattcctttcacccagatccaacctcaggctcc
ttccagaggccacagggggaaagcaacatagccagtggccgtcctatgttcttcccactg
aacaaactacagtcccctaaacatgcctatgtgaaagaagacacagtgttcctcaagtgt
gttgtagaaactaactcataa

KEGG   Phascolarctos cinereus (koala): 110222706
Entry
110222706         CDS       T05867                                 

Gene name
TRAF5
Definition
(RefSeq) TNF receptor-associated factor 5 isoform X1
  KO
K09849  TNF receptor-associated factor 5
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04064  NF-kappa B signaling pathway
pcw04217  Necroptosis
pcw04621  NOD-like receptor signaling pathway
pcw04657  IL-17 signaling pathway
pcw04668  TNF signaling pathway
pcw05163  Human cytomegalovirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110222706 (TRAF5)
   04668 TNF signaling pathway
    110222706 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110222706 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110222706 (TRAF5)
   04657 IL-17 signaling pathway
    110222706 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110222706 (TRAF5)
   05203 Viral carcinogenesis
    110222706 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110222706 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110222706 (TRAF5)
   05168 Herpes simplex virus 1 infection
    110222706 (TRAF5)
   05163 Human cytomegalovirus infection
    110222706 (TRAF5)
   05169 Epstein-Barr virus infection
    110222706 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pcw04121]
    110222706 (TRAF5)
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    110222706 (TRAF5)
SSDB
Motif
Pfam: zf-TRAF zf-TRAF_2 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 DUF4941 zf-RING_6 zf-RING_5 zf-RING_UBOX HMMR_N
Other DBs
NCBI-GeneID: 110222706
NCBI-ProteinID: XP_020863510
UniProt: A0A6P5M1C8
LinkDB
Position
Unknown
AA seq 560 aa
MASSTSEEQGSASSNFIPQNSSNYISLDFEPNMEYQFVEQLEERYKCASCHSVLHNPHQT
GCGHRFCENCILSLRELNAVSICPVDKEIIKPQEVFKDNCCKREVLNLQVFCKNAPHCAA
KMILGRFQDHLLQCLFQPVQCSNECCQERVLRKDLKDHLGLHCQFREETCPYCKKDIVVI
SLQNHKEKFCPDYPVSCPNNCLQIIPRTKVDEHITVCPEVEQECPYKHYGCPVKDKRVNL
KEHENSALREHMLLVLEKNCRLEEQIYDLHKNLELKESKIQQLSETVKKFEKEFRQFVQL
FGKNGNLLANTQVLASHIDKSAWLETQVRELLEAANQQQNKFDLRPLMNTIDTIKQKITL
LETYDQRLVTLEGQTNRHDAHINVHKAQLNKNEERFKMLEGTCYNGKLIWKVTDYKMKKR
EATEGRTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMKGEFDSLLQWPF
KQRVTMMLLDQSGKKNHITEIFKADPNSSSFKRPDGEMNIASGCPRFVAHSTLENTKNTY
IKEDTLFMKVVVDLSDLEDL
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggcatcctcaacctctgaagaacaggggagtgcctccagcaacttcattccccagaat
tccagtaactacatatccttggactttgaacccaacatggaataccaatttgtagaacaa
ttagaagaacgttataaatgtgcatcatgccattctgttcttcacaacccgcatcagact
ggctgtggacatcgattctgtgagaactgtatcctatccttgagagaattaaatgcagtg
tccatctgtcctgtagacaaggagattatcaaaccccaggaggtgtttaaagataattgc
tgcaaacgagaagtcctcaatttacaggtcttttgcaaaaacgctccccattgtgctgcc
aagatgattctggggcgattccaggatcaccttctacagtgtttattccagcctgtgcag
tgttctaatgagtgctgtcaggaaagagtccttcgaaaagatttgaaagaccatttgggc
ttacattgtcagtttcgagaggaaacgtgcccatattgcaaaaaggatatagtggtaatc
agtttacagaatcacaaggaaaaattttgccctgactaccctgtatcttgtcccaataac
tgtttacaaattattcccagaactaaggttgatgagcatattactgtgtgtcctgaggtg
gaacaagaatgcccctataagcattatggctgtcctgtaaaggacaaaagggtaaatctt
aaggaacatgagaattctgctttaagagaacacatgctcctggttttagaaaagaactgc
agattagaagaacagatttatgacttgcacaagaacttagaattaaaggaaagtaaaatt
cagcagttaagtgaaactgtgaagaaatttgaaaaggagtttaggcaatttgtacaactg
tttggcaaaaatggtaacttgctggcaaatacccaggttcttgccagtcacattgataaa
tctgcttggttggaaacacaagtaagggagttactagaggcggctaaccagcagcaaaac
aaatttgatctaagacctttgatgaatacaattgatactataaagcagaagatcactttg
ctggaaacctatgaccagagattggtcacgttggaaggccaaactaacagacatgatgcc
cacattaatgtccacaaagcccagctgaataaaaatgaagagcgatttaaaatgttagaa
ggcacttgttataatggcaaattgatatggaaggtgacggattacaagatgaaaaaaaga
gaagcaacagaagggcgcacagtgtccatattcagccagcctttctacaccagccgctgt
ggctaccgactctgtgcaagagcttacttgaatggagatgggtcagggaaagggacacat
ttatccctgtattttgttgtgatgaaaggggaattcgactcattgttgcagtggcctttc
aagcagagagttaccatgatgcttttggatcagagtggaaaaaagaaccacattacagag
atcttcaaggctgaccccaatagcagtagctttaaaagacctgatggagagatgaacatt
gcatcgggctgtcctcgctttgtggcacattccactctggagaacaccaagaacacctac
atcaaagaagataccctctttatgaaagtggttgtagatctatctgatcttgaggacctg
taa

DBGET integrated database retrieval system