KEGG   Phascolarctos cinereus (koala): 110194271
Entry
110194271         CDS       T05867                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04010  MAPK signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04137  Mitophagy - animal
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04216  Ferroptosis
pcw04218  Cellular senescence
pcw04310  Wnt signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110194271 (TP53)
   04310 Wnt signaling pathway
    110194271 (TP53)
   04071 Sphingolipid signaling pathway
    110194271 (TP53)
   04151 PI3K-Akt signaling pathway
    110194271 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110194271 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    110194271 (TP53)
   04210 Apoptosis
    110194271 (TP53)
   04216 Ferroptosis
    110194271 (TP53)
   04115 p53 signaling pathway
    110194271 (TP53)
   04218 Cellular senescence
    110194271 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110194271 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110194271 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    110194271 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110194271 (TP53)
   05202 Transcriptional misregulation in cancer
    110194271 (TP53)
   05206 MicroRNAs in cancer
    110194271 (TP53)
   05205 Proteoglycans in cancer
    110194271 (TP53)
   05203 Viral carcinogenesis
    110194271 (TP53)
   05230 Central carbon metabolism in cancer
    110194271 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110194271 (TP53)
   05212 Pancreatic cancer
    110194271 (TP53)
   05225 Hepatocellular carcinoma
    110194271 (TP53)
   05226 Gastric cancer
    110194271 (TP53)
   05214 Glioma
    110194271 (TP53)
   05216 Thyroid cancer
    110194271 (TP53)
   05220 Chronic myeloid leukemia
    110194271 (TP53)
   05217 Basal cell carcinoma
    110194271 (TP53)
   05218 Melanoma
    110194271 (TP53)
   05219 Bladder cancer
    110194271 (TP53)
   05215 Prostate cancer
    110194271 (TP53)
   05213 Endometrial cancer
    110194271 (TP53)
   05224 Breast cancer
    110194271 (TP53)
   05222 Small cell lung cancer
    110194271 (TP53)
   05223 Non-small cell lung cancer
    110194271 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110194271 (TP53)
   05014 Amyotrophic lateral sclerosis
    110194271 (TP53)
   05016 Huntington disease
    110194271 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110194271 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110194271 (TP53)
   05161 Hepatitis B
    110194271 (TP53)
   05160 Hepatitis C
    110194271 (TP53)
   05162 Measles
    110194271 (TP53)
   05168 Herpes simplex virus 1 infection
    110194271 (TP53)
   05163 Human cytomegalovirus infection
    110194271 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110194271 (TP53)
   05169 Epstein-Barr virus infection
    110194271 (TP53)
   05165 Human papillomavirus infection
    110194271 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110194271 (TP53)
   01522 Endocrine resistance
    110194271 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110194271 (TP53)
   03036 Chromosome and associated proteins [BR:pcw03036]
    110194271 (TP53)
   03400 DNA repair and recombination proteins [BR:pcw03400]
    110194271 (TP53)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    110194271 (TP53)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110194271 (TP53)
DNA repair and recombination proteins [BR:pcw03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110194271 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 110194271
NCBI-ProteinID: XP_020822126
UniProt: A0A6P5IIX8
LinkDB
Position
Unknown
AA seq 371 aa
MEESLSDLEPPLSQETFSDIWNLQWNNMPDDLSNIDDIQFASPDDINWLGNEEENPGLQV
PAPPVNLPTSSTVPSRKDYPGEYGFRLGFLHSGTAKSVTCTYSPELNKLFCQLAKTCPVQ
LWVTSPPPAGARVRAMAIYKKSEHMTEVVKRCPHHERCTEHIDALAPPQHLIRVEGNLRA
EYLNDATTMRQSVSIPYESPEVGCDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGQ
LLGRRSFEVRVCACPGRDRRTEEENFRKKGGHNPQPSSESNKRALPTTPSSTPKAKKKLM
DGEYFTLQIRGRHRYEVFRELNEALELKDAHSGKEAEGSCPHRSQLKSKKGDSTPSQGKR
LLVKSEVPDSD
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggaggaatcactgtcagatctggagcccccactgagccaggagaccttctcagacata
tggaatttacaatggaacaatatgccagatgatttatcgaacatagatgatatacagttt
gcctcaccagacgatataaactggctgggaaatgaggaagaaaaccctggacttcaagtg
cctgcacctccagttaacctgcctacatcgtctaccgttccatcccgaaaggactatcct
ggggagtatggcttcaggcttggttttctacactccggaacagccaagtctgtcacctgc
acgtactcccctgagctgaacaagctgttttgccaactggccaaaacctgccctgtccag
ctctgggtcacttcaccaccacctgctggtgcccgagttcgagctatggctatttataag
aagtcagaacacatgaccgaggtggttaagcgctgtccccaccatgaacgatgcaccgag
cacatagatgccctggcacccccacagcacctgatccgggtggaaggaaacctacgggct
gaataccttaatgatgccaccaccatgcgccagagtgtgtccattccttatgagtcccca
gaggtcggctgtgattgcactacaattcattacaattatatgtgcaacagttcctgcatg
gggggcatgaaccgacgccccatcctcaccataataactttggaagactccagcggtcaa
ctccttggacgtcgaagctttgaagtacgtgtatgcgcctgtcctggaagagaccgaagg
actgaagaggaaaatttccgcaagaagggaggtcacaacccacagccatcctctgagagc
aataagcgggcattacccacaactcctagcagcacccccaaggctaaaaagaagctaatg
gatggagaatatttcaccctccagatccggggtcgccaccgctatgaggtattccgggag
ctgaatgaagccttggaactgaaagatgctcacagtgggaaagaagctgaggggagctgt
ccccaccgcagccaattgaagtccaagaaaggagattctaccccctctcaaggcaaaaga
cttttggtgaaaagtgaagttcctgactctgactga

DBGET integrated database retrieval system