Phascolarctos cinereus (koala): 110194271 Help Entry 110194271         CDS       T05867                                  Gene name TP53 Definition (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01522   Endocrine resistance pcw01524   Platinum drug resistance pcw04010   MAPK signaling pathway pcw04071   Sphingolipid signaling pathway pcw04110   Cell cycle pcw04115   p53 signaling pathway pcw04137   Mitophagy - animal pcw04151   PI3K-Akt signaling pathway pcw04210   Apoptosis pcw04211   Longevity regulating pathway pcw04216   Ferroptosis pcw04218   Cellular senescence pcw04310   Wnt signaling pathway pcw04722   Neurotrophin signaling pathway pcw04919   Thyroid hormone signaling pathway pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05165   Human papillomavirus infection pcw05166   Human T-cell leukemia virus 1 infection pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05200   Pathways in cancer pcw05202   Transcriptional misregulation in cancer pcw05203   Viral carcinogenesis pcw05205   Proteoglycans in cancer pcw05206   MicroRNAs in cancer pcw05210   Colorectal cancer pcw05212   Pancreatic cancer pcw05213   Endometrial cancer pcw05214   Glioma pcw05215   Prostate cancer pcw05216   Thyroid cancer pcw05217   Basal cell carcinoma pcw05218   Melanoma pcw05219   Bladder cancer pcw05220   Chronic myeloid leukemia pcw05222   Small cell lung cancer pcw05223   Non-small cell lung cancer pcw05224   Breast cancer pcw05225   Hepatocellular carcinoma pcw05226   Gastric cancer pcw05230   Central carbon metabolism in cancer pcw05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110194271 (TP53)    04310 Wnt signaling pathway     110194271 (TP53)    04071 Sphingolipid signaling pathway     110194271 (TP53)    04151 PI3K-Akt signaling pathway     110194271 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     110194271 (TP53)   09143 Cell growth and death    04110 Cell cycle     110194271 (TP53)    04210 Apoptosis     110194271 (TP53)    04216 Ferroptosis     110194271 (TP53)    04115 p53 signaling pathway     110194271 (TP53)    04218 Cellular senescence     110194271 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     110194271 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     110194271 (TP53)   09149 Aging    04211 Longevity regulating pathway     110194271 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110194271 (TP53)    05202 Transcriptional misregulation in cancer     110194271 (TP53)    05206 MicroRNAs in cancer     110194271 (TP53)    05205 Proteoglycans in cancer     110194271 (TP53)    05203 Viral carcinogenesis     110194271 (TP53)    05230 Central carbon metabolism in cancer     110194271 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     110194271 (TP53)    05212 Pancreatic cancer     110194271 (TP53)    05225 Hepatocellular carcinoma     110194271 (TP53)    05226 Gastric cancer     110194271 (TP53)    05214 Glioma     110194271 (TP53)    05216 Thyroid cancer     110194271 (TP53)    05220 Chronic myeloid leukemia     110194271 (TP53)    05217 Basal cell carcinoma     110194271 (TP53)    05218 Melanoma     110194271 (TP53)    05219 Bladder cancer     110194271 (TP53)    05215 Prostate cancer     110194271 (TP53)    05213 Endometrial cancer     110194271 (TP53)    05224 Breast cancer     110194271 (TP53)    05222 Small cell lung cancer     110194271 (TP53)    05223 Non-small cell lung cancer     110194271 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     110194271 (TP53)    05014 Amyotrophic lateral sclerosis     110194271 (TP53)    05016 Huntington disease     110194271 (TP53)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110194271 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110194271 (TP53)    05161 Hepatitis B     110194271 (TP53)    05160 Hepatitis C     110194271 (TP53)    05162 Measles     110194271 (TP53)    05168 Herpes simplex virus 1 infection     110194271 (TP53)    05163 Human cytomegalovirus infection     110194271 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     110194271 (TP53)    05169 Epstein-Barr virus infection     110194271 (TP53)    05165 Human papillomavirus infection     110194271 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110194271 (TP53)    01522 Endocrine resistance     110194271 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pcw03000]     110194271 (TP53)    03036 Chromosome and associated proteins [BR:pcw03036]     110194271 (TP53)    03400 DNA repair and recombination proteins [BR:pcw03400]     110194271 (TP53) Transcription factors [BR:pcw03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     110194271 (TP53) Chromosome and associated proteins [BR:pcw03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      110194271 (TP53) DNA repair and recombination proteins [BR:pcw03400]  Eukaryotic type   Check point factors    Other check point factors     110194271 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  110194271 NCBI-ProteinID:  XP_020822126 UniProt:  A0A6P5IIX8 LinkDB All DBs Position Unknown AA seq 371 aa AA seqDB search MEESLSDLEPPLSQETFSDIWNLQWNNMPDDLSNIDDIQFASPDDINWLGNEEENPGLQV PAPPVNLPTSSTVPSRKDYPGEYGFRLGFLHSGTAKSVTCTYSPELNKLFCQLAKTCPVQ LWVTSPPPAGARVRAMAIYKKSEHMTEVVKRCPHHERCTEHIDALAPPQHLIRVEGNLRA EYLNDATTMRQSVSIPYESPEVGCDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGQ LLGRRSFEVRVCACPGRDRRTEEENFRKKGGHNPQPSSESNKRALPTTPSSTPKAKKKLM DGEYFTLQIRGRHRYEVFRELNEALELKDAHSGKEAEGSCPHRSQLKSKKGDSTPSQGKR LLVKSEVPDSD NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt atggaggaatcactgtcagatctggagcccccactgagccaggagaccttctcagacata tggaatttacaatggaacaatatgccagatgatttatcgaacatagatgatatacagttt gcctcaccagacgatataaactggctgggaaatgaggaagaaaaccctggacttcaagtg cctgcacctccagttaacctgcctacatcgtctaccgttccatcccgaaaggactatcct ggggagtatggcttcaggcttggttttctacactccggaacagccaagtctgtcacctgc acgtactcccctgagctgaacaagctgttttgccaactggccaaaacctgccctgtccag ctctgggtcacttcaccaccacctgctggtgcccgagttcgagctatggctatttataag aagtcagaacacatgaccgaggtggttaagcgctgtccccaccatgaacgatgcaccgag cacatagatgccctggcacccccacagcacctgatccgggtggaaggaaacctacgggct gaataccttaatgatgccaccaccatgcgccagagtgtgtccattccttatgagtcccca gaggtcggctgtgattgcactacaattcattacaattatatgtgcaacagttcctgcatg gggggcatgaaccgacgccccatcctcaccataataactttggaagactccagcggtcaa ctccttggacgtcgaagctttgaagtacgtgtatgcgcctgtcctggaagagaccgaagg actgaagaggaaaatttccgcaagaagggaggtcacaacccacagccatcctctgagagc aataagcgggcattacccacaactcctagcagcacccccaaggctaaaaagaagctaatg gatggagaatatttcaccctccagatccggggtcgccaccgctatgaggtattccgggag ctgaatgaagccttggaactgaaagatgctcacagtgggaaagaagctgaggggagctgt ccccaccgcagccaattgaagtccaagaaaggagattctaccccctctcaaggcaaaaga cttttggtgaaaagtgaagttcctgactctgactga

DBGET integrated database retrieval system