KEGG   Phascolarctos cinereus (koala): 110194600
Entry
110194600         CDS       T05867                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw04012  ErbB signaling pathway
pcw04062  Chemokine signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04510  Focal adhesion
pcw04670  Leukocyte transendothelial migration
pcw04810  Regulation of actin cytoskeleton
pcw04935  Growth hormone synthesis, secretion and action
pcw05100  Bacterial invasion of epithelial cells
pcw05135  Yersinia infection
pcw05146  Amoebiasis
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05205  Proteoglycans in cancer
pcw05222  Small cell lung cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110194600 (PTK2)
   04370 VEGF signaling pathway
    110194600 (PTK2)
   04151 PI3K-Akt signaling pathway
    110194600 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110194600 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110194600 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110194600 (PTK2)
   04062 Chemokine signaling pathway
    110194600 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110194600 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    110194600 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110194600 (PTK2)
   05202 Transcriptional misregulation in cancer
    110194600 (PTK2)
   05205 Proteoglycans in cancer
    110194600 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110194600 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110194600 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110194600 (PTK2)
   05100 Bacterial invasion of epithelial cells
    110194600 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110194600 (PTK2)
   05163 Human cytomegalovirus infection
    110194600 (PTK2)
   05165 Human papillomavirus infection
    110194600 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110194600 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110194600 (PTK2)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110194600 (PTK2)
Protein kinases [BR:pcw01001]
 Non-receptor tyrosine kinases
  FAK family
   110194600 (PTK2)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110194600 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 110194600
NCBI-ProteinID: XP_020822686
UniProt: A0A6P5IUR9
LinkDB
Position
Unknown
AA seq 1112 aa
MLLELAGQPALKPAGAIYMEKSGCSPFPICWAKEYDRYLASSKTMAAAYLDPNLNHAPSS
STKTHLSTGMERSPGAMERVLKVFHYFENSNEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLESVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGSNPTHLADFNQVQTIQYSNSDDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANNEKQGVRTHTVSVSDEISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIE
LGRCIGEGQFGDVHQGVYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHI
VKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFV
HRDIAARNVLVSSADCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSAS
DVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDP
SRRPRFTELKAQLSTILEEEKLQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSP
RSSEGFYPSPQHMVQANHYQVSGYPGSHGITAMAGSIYPGQASLLDQTESWNHRPQEVSM
WQPNMEDSATLDMRGLGQVLPAHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGS
IDREDGSLQGPTGNQHIYQPVGKPDHAAPPKKPPRPGAPSHLGSLASLNSPVDSYNEGVK
PWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPMLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQARPH
NT seq 3339 nt   +upstreamnt  +downstreamnt
atgttgttggaactggctggccaaccggccctgaaaccagcaggtgctatctatatggag
aaaagcggctgtagcccatttccaatatgctgggctaaagaatatgacagatacctagca
tctagcaaaaccatggcagctgcttaccttgacccaaacttgaatcacgccccaagttca
agtacaaagacacacctcagtactgggatggagcgttctcctggggcaatggagcgagta
ttaaaagtctttcattattttgaaaatagtaatgagccaaccacatgggccagtattatt
aggcatggagatgccactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcatgtggcctgttatggatttcgactcagtcatcttcgttcagaggaagttcac
tggctgcatttggatatgggtgtttccaatgtgagagaaaaatatgaactagcccaccca
ccggaggagtggaaatatgagttgagaattcgttatttgccaaaaggatttctgaaccag
tttacagaagacaagccaactttgaatttcttttatcagcaggtgaaaaacgactatatg
ttagaaatagctgatcaagtggaccaggaaattgctttgaagttgggttgccttgaaata
cggagatcatactgggagatgaggggcaatgccctggagaagaaatctaactatgaagta
ttagaaaaggatgttggtttaaagagattttttcctaagagtttgctggaatctgtcaag
gccaaaaccctcagaaaactgatacagcaaacatttcgtcaatttgccaacctaaataga
gaagaaagtattctgaaattctttgagattctctctcctgtgtacagatttgataaagaa
tgcttcaaatgtgctcttgggtcaagttggatcatttccgtggagctggcaattggccca
gaagaaggcatcagttaccttacagacaagggctccaatcctacacatctcgcagacttc
aatcaagttcagaccattcagtattcaaacagtgatgacaaagacagaaaaggaatgctg
caactcaaaatagcaggagcacctgagcctctcacagtgacagccccatctttaaccatt
gcagagaatatggctgacttaatcgatggatattgccgactagttaatggagccacacag
tcttttatcattagaccccagaaagaaggtgaacgagccttaccatccataccaaagcta
gccaacaatgagaagcaaggagtaaggacacatacagtctctgtgtcagatgaaattagt
ggggacgaaacagatgactacgctgagattatagatgaagaagatacttatacaatgccc
tcaaaaagctatggaatagatgaagccagggattatgagatacaaagggaaaggatagaa
cttggacgctgtattggagaaggccagtttggagatgtacatcaaggagtttacatgagt
ccagagaatccagcaatggcagttgcaattaaaacatgtaaaaattgtacctcagacagt
gtgagagaaaaattccttcaagaagccttaacaatgcgtcagtttgaccacccacatatt
gtgaaattgattggagtcataacagaaaatccagtctggataatcatggagctctgcaca
ctaggggagctgagatcatttttgcaagtgagaaaatacagcttggatttggcatctttg
attctatatgcttaccagcttagtacagcccttgcctacctagaaagtaaaagatttgtg
catagggacattgctgctagaaatgtgctggtatcttcagctgactgtgtaaaattagga
gactttggtttgtctcgatatatggaagatagtacttactacaaagcttccaaaggaaaa
ttacctattaaatggatggctccagagtcaatcaactttagacgttttacctcagctagt
gatgtatggatgtttggtgtgtgcatgtgggaaattttgatgcatggtgtaaagcctttc
caaggagtgaagaacaatgacgtaattggtcgaattgaaaatggtgaacggttaccaatg
cctccaaattgtcctcctaccctttacagccttatgactaaatgctgggcatatgatccc
agcagacgacccaggtttactgaactcaaagcacagctcagtacaatactggaggaggag
aagcttcagcaagaagaacgaatgagaatggaatccagaaggcaggtcacagtgtcctgg
gattcaggaggctcagacgaagctcctcccaagcccagccgacctggttatcctagccca
agatccagtgaaggcttttatcctagtccacaacatatggtacaagccaatcattatcag
gtctctggctatcctggttctcatggaataacagccatggctggcagcatttatcctggt
caggcatctctgttggaccaaacagagtcttggaaccaccgacctcaagaggtgtcaatg
tggcagcccaacatggaggattctgccacattggacatgaggggattaggccaggtcctt
ccagcacatcttatggaagagaggttgatacgacagcagcaggaaatggaagaagatcag
cgttggcttgagaaggaggagagatttttgaaacctgatgtgaggctctctcgaggcagt
attgaccgagaggatggaagtcttcagggtccgactggtaaccagcacatatatcaacct
gtgggtaagccagatcatgcagctccaccaaagaaaccacctcgcccaggagcacccagc
catctgggaagccttgccagcctcaacagccctgtggatagttataatgaaggagtaaag
ccatggaggctgcagccccaggaaatcagccccccacctactgccaatctggaccgctct
aatgacaaggtctatgaaaatgtaaccggcttggtgaaagctgtcatagaaatgtccagc
aagatccagcctgcccccccagaggaatatgttcctatggtaaaggaagttggcttggcc
ctaagaacattgctagcaacagtggatgagaccattcctatgcttccagcaagcactcac
agagagattgagatggcccaaaagctgttgaattcggacttgggtgagctgatcaacaag
atgaaattggcacaacaatacgtcatgaccagccttcagcaggaatacaaaaagcaaatg
ctaactgccgctcatgcactggctgtagatgccaaaaacttactagatgtcattgaccaa
gcaagattgaaaatgctggggcaggccaggccacactga

DBGET integrated database retrieval system