KEGG   Phascolarctos cinereus (koala): 110194741
Entry
110194741         CDS       T05867                                 

Gene name
COL4A5
Definition
(RefSeq) collagen alpha-5(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04926  Relaxin signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04974  Protein digestion and absorption
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110194741 (COL4A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110194741 (COL4A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110194741 (COL4A5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110194741 (COL4A5)
  09154 Digestive system
   04974 Protein digestion and absorption
    110194741 (COL4A5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110194741 (COL4A5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110194741 (COL4A5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110194741 (COL4A5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110194741 (COL4A5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110194741 (COL4A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110194741 (COL4A5)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110194741 (COL4A5)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110194741 (COL4A5)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110194741 (COL4A5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110194741
NCBI-ProteinID: XP_020822922
UniProt: A0A6P5ILB3
LinkDB
Position
Unknown
AA seq 1682 aa
MRAAAGLLFFLGLSQWGWPADAAACHGCSSGPKCDCGGIKGEKGERGLPGLEGHPGLPGF
PGAEGPPGPPGQKGDDGAPGPLGPKGIRGPPGLPGFPGTPGLPGMPGLNGAPGPQGIPGC
NGTKGERGFPGISGVPGLPGPPGPLGIPGMKGLPGSIILSTLPGPKGDPGDPGLPGRQGP
AGVTGSPGPLGSPGLPGWMGPPGPPGIQGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQI
GELKGSNETELLKGDQGTPGDRGSPGLPGLRGPPGLPGGMKGEKGQQGEPGQKGRPGRDG
ASGLPGMQGLPGDPGIPGKPGRGGEKGQKGDTGPAGLPGLVIPWPGTGEKGNLGLPGLPG
EKGDQGFPGVPGLSGLPGPPGTIIIGPPGPPGFPGERGEKGAKGLPGITIPGQPGLDGRP
GTPGLPGTPGEPGPHFPSNGEICEKGARGPPGSPGDRGMPGEQGVKGDKGDTCLNCIEIG
LPGSPGQPGLPGPPGLTGARGFPGQKGAKGNVGATGRENSIFFSLFGSQGLPGVPGTSGL
PGPKGSPGDTLTFPEMKGDKGDAGSPGAPGIPGLPGTPGQDGLPGLPGLKGKPGGFALKG
ERGLPGKPGLPGLPGNRGPMGPPGLGPPGPVGEKGMQGMAGNPGPPGVSGAKGDPGPTIS
QPGPPGLPGLPGRDGDVGLPGDPGLPGVPGSPGIPGSKGEPGSPGIGLPGPPGLKGYQGM
PGPPGTPGAPGRRGLQGSPGHRGFPGPKGEPGLGLPGPPGLRGLPGLKGTPGPKGSAGFP
GPPGIPGLPGLDGLAGPKGDPGAVGQPGLIGPSGPPGIGRQGHPGPPGIPGPLGQPGLPG
APGGKGDPGPPGFDISGPPGERGPRGIPGTPGIMGPQGSPGPPGQDGAPGLSGAKGEMGK
LGPPGPPGPLGIPGRNGIPGLKGEEGLPGQAGFPGPVGQKGGKGEPGVPGPPGQVDPNCQ
TVKGEKGEPGSPGIPGALGLKGSQGIPGDPGQPGLVGQPGSPGPPGPKGNQGLPGRPGPV
GPPGLKGRIGDMGFPGLQGVEGSPGMPGVAGQPGSPGFLGQNGDKGAPGVAEIGHPGLPG
PKGDPGLPGYPGTPGTQGALGDIGLPGAPGSPGVKGRPGFPGWPGTTGLPGPKGLDGPPG
SPGIPGQSGPVGSQGHPGSPGSPGEKGKPGQDGIPGPPGQKGEPGQPGFGFPGPPGIPGF
PGEKGDEGSPGTPGKPGPQGPKGERGYPGFPGIRGPPGPAGSPGQNREGLKGNPGPRGRP
GRPGPRGPWGDPGNGRVKGKRGDPGPLGKPGLPGFKGEQGPPGPQGDPGRPGRIGMKGNP
GIQGIPGFQGMKGPTGAPGSAGPAGDPGPRGPSGPPGFPGPSEQDLIVKGDIGPPGPPGQ
PGLKGLPGIPGPQGLPGLTGPPGDPGRNGRLGVNGPEGHKGDPGPSGQPGSRGIDGSPGP
DGLPGLPGPPGTLSLAHGFLITRHSQTTDTPQCPRGTVQIYRGFSLLYVQGNERAHGQDL
GTSGSCLHRFSTMPFMFCNINNVCNFASRNDYSYWLSTPKPMPMTMEPLKGQSILPFISR
CSVCEAPATVIAIHSQTTQIPHCPQGWDSLWIGYSFMMHMSAGAEGSGQALASPGSCLEE
FRSAPFIECHGRGTCNYYANSYSFWLATVEASDMFSNPEPETLKTGDLRTRISRCQVCMK
RT
NT seq 5049 nt   +upstreamnt  +downstreamnt
atgagggcggccgccggcttgctcttcttcctgggcctgagccagtggggctggcccgcc
gatgcggccgcttgccatgggtgttcatctggacccaagtgtgactgcggtggaataaaa
ggggagaagggagagagaggacttccaggtttggaaggccacccaggtttacctggattt
cctggagcagaaggacctcctgggcctccaggccaaaagggtgatgacggtgctcctggg
ccactgggcccgaagggaatcagggggccccctggacttcctggattcccagggacacca
ggtcttcctggaatgccaggccttaatggagccccaggacctcagggcatcccagggtgc
aacgggacaaagggggaacgtggattcccaggcatttctggtgttccaggtttaccaggt
cccccaggtcctcttgggatcccagggatgaaggggctgccagggagtataattctgtcc
acactgccaggcccgaagggggacccaggcgatccagggcttccaggaagacaaggccca
gctggtgtgactggaagtccaggtcctcttggttcccccggcctaccagggtggatgggg
cctcctgggccaccaggaattcaaggaccaaaggggaatatgggcttgaatttccagggc
cccaaaggtgaaaaaggtgaacaagggctgcagggcccacctggccccccggggcagatt
ggggaactgaagggatcaaatgagacggagctgctgaaaggagatcagggtaccccaggt
gaccgaggctcacctggacttcctgggctccgtgggcctcctggtcttcctggtggtatg
aagggtgaaaaaggccagcaaggggaaccaggccagaaaggtaggccaggcagagatgga
gccagtggcctcccgggcatgcaaggcttgcctggtgatcctggtattcctggtaaacct
ggaaggggtggtgaaaagggtcaaaaaggtgatactggccccgctggcctgcctggactt
gtaattccttggcctgggactggtgaaaaagggaacctgggcttgcctggtttgcctgga
gagaaaggagatcaaggattccctggggtaccaggtctgtctggccttcctgggcctcca
gggaccattatcataggccctcctggaccgcctggctttcctggggaaaggggcgagaag
ggagctaaaggtctgcctggcatcaccatacctggacagcctggacttgacgggcggcct
gggactcctggtctccctgggactccgggcgaaccaggacctcatttcccttctaatggt
gagatatgtgaaaagggagctcggggcccaccaggatctccaggggacagaggaatgcca
ggagagcaaggagtaaaaggagacaagggggacacctgcctcaactgtattgaaattggc
cttcctggatctccagggcagcctggactgccaggacctccaggtcttacaggagctcgt
ggtttccctgggcagaaaggcgccaaaggaaatgtcggtgccactggccgggaaaacagc
atttttttttctctttttgggtctcagggccttccaggagttccaggtacctcaggatta
ccaggtccaaaaggaagtccaggggacaccctcactttcccagaaatgaagggtgacaaa
ggagatgctggttccccaggggctccagggattcctggtttgcctggcactccaggacaa
gatggattgcctgggcttcctggcctcaaaggaaaacctggtggctttgctttaaaaggt
gaaagaggtctccctgggaagccaggtttgccaggtctccctgggaacagagggcccatg
ggtcctcctggtttgggcccaccaggccctgtgggtgaaaaaggcatgcaaggcatggca
ggaaatccaggtcctccaggagtctcaggtgccaaaggtgatccaggtccgactatatcc
cagccagggcctcctggcttgcctggcttacccggcagggatggtgatgtgggtcttcca
ggtgacccagggcttccaggggtgccaggctcaccaggaatccctggtagtaaaggggaa
ccaggtagccctggcattggtcttcctggaccaccaggtctcaaaggttaccagggaatg
ccggggcctccgggaacccctggggcacctggaagacgtggtctacaaggctctcctggg
catcgtggcttcccaggtccaaagggagagccagggcttggcctgcctgggccacctggg
ctcaggggactcccaggtctcaaaggaacacctggtccaaaaggcagtgctggtttccca
gggcccccaggcatcccagggctccctggcttggatgggctggctggaccaaaaggtgac
cctggagcagttggacagcctggacttataggtccttctgggccaccaggaattggccgt
cagggacatccaggaccaccagggattcctggacctctaggtcaaccaggcttgccggga
gccccaggaggaaagggagacccaggaccccctgggtttgatatctcagggcctcctggt
gagagaggccctcgaggcattcctggaacacctggtatcatggggcctcaaggttcccca
gggcccccgggacaagatggtgcccctgggctttcaggtgccaaaggtgaaatggggaag
ttggggcctccaggaccaccgggacctttaggaattcctggaaggaatggtattcctggc
ttgaaaggtgaggagggtttgccgggtcaggcaggatttcctggtcctgtaggacaaaaa
ggtggaaaaggcgagcctggtgttccaggccctcctggacaagtggatccgaactgtcag
acagtaaagggggagaagggagaaccaggctcaccaggcattcctggagcattgggtctc
aaaggctcccaaggtattcctggagacccaggacaacctggactggttgggcagcctggt
tcccctggaccaccaggccccaagggaaaccaaggccttccagggcgaccaggaccagta
ggccctcctggattaaaaggacgcataggagacatgggatttccgggtctccaaggtgtg
gaagggtctccagggatgcctggagttgctggccagcctggctccccaggatttcttgga
caaaatggagacaaaggagctcctggggttgcagaaattggtcacccgggtctcccaggt
cctaagggtgatcctggcctgcctgggtacccaggtactcctggcactcaaggtgccctg
ggagatattggtttgcctggtgctccagggagccctggggtaaaaggacggccaggcttt
cccggatggccaggtactacaggacttcctggacccaaaggtctggatggcccacctggc
agccctggtatcccaggacagtctggtcctgtaggcagtcagggccatcctggttcccca
ggatctccaggagagaaagggaaacctggtcaagatggaattcctgggccacctggacag
aagggtgaaccaggtcaaccaggatttggattcccaggacctccaggaatcccaggattt
cctggtgagaagggtgatgaaggttcaccaggcactccaggaaagcctggccctcaaggc
ccaaaaggtgaacggggctatcctggcttccctggcatacgagggcccccaggtcctgct
ggctctccaggtcaaaatcgagaaggtctcaaagggaaccctgggcctcgaggtcgtcct
gggagaccagggcctagaggtccctggggtgaccctggaaacggacgagtgaaaggaaag
aggggagaccccggcccacttgggaagcctggtttgcctggtttcaaaggagaacaaggc
ccacctgggccccagggtgatcctgggcggccagggcgcattggaatgaagggaaatcct
ggcatccaaggtatcccaggattccaagggatgaaaggacctactggtgctcctggttca
gctggccctgcaggggatccaggccctagaggtccttcaggtccccctggctttcctgga
ccctctgagcaggatctcatagtcaaaggagatattggacctccaggaccaccaggccag
ccaggattaaaaggtctcccagggatcccaggaccccaaggtttgccaggtctaactggc
ccaccaggagaccctggacgtaatggacgccttggtgttaatggcccagaaggccacaaa
ggagacccaggcccatcaggtcaaccaggtagccgtggaatagacggttccccaggacca
gatggcttgccagggctaccaggtcccccgggaaccctttctcttgcccatggatttctc
atcacacgtcatagccagaccacagatacaccacagtgcccccgaggaactgtacagatc
tacagagggttttctctcctgtatgtgcaaggaaatgagagggcccatggccaagacttg
gggacgtcgggcagctgcctccaccgcttcagcaccatgcctttcatgttctgtaatatc
aacaatgtatgcaactttgcctccagaaatgactactcctactggctgtccactcccaag
cccatgccaatgaccatggagccgctgaagggacaaagcatcttgccatttatcagtcga
tgctcagtatgtgaagccccagcaacagtgattgcaattcacagtcagaccacccagatc
ccccattgcccacagggctgggattctctctggattggttattcctttatgatgcacatg
agtgctggtgcagagggctctggccaggccctggcctctcctggttcctgcctggaagaa
ttccgttcagcccccttcattgaatgtcacggacggggaacttgcaactactatgccaac
tcctacagcttctggctggcaactgtggaggcatcagacatgttcagtaacccagaacca
gagactctcaaaacaggagacttgaggacacgcattagtcgatgtcaagtttgtatgaag
aggacataa

KEGG   Phascolarctos cinereus (koala): 110195785
Entry
110195785         CDS       T05867                                 

Gene name
LAMA3
Definition
(RefSeq) laminin subunit alpha-3 isoform X1
  KO
K06240  laminin, alpha 3/5
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110195785 (LAMA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110195785 (LAMA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110195785 (LAMA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110195785 (LAMA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110195785 (LAMA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110195785 (LAMA3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110195785 (LAMA3)
   05145 Toxoplasmosis
    110195785 (LAMA3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_G_2 Laminin_N Laminin_I Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 110195785
NCBI-ProteinID: XP_020824350
UniProt: A0A6P5IQF9
LinkDB
Position
Unknown
AA seq 3439 aa
MARVRKGSPAAASAPRWLPRLLLLLLSPLSAAAVSPDPDAGFSLHPPYFNLAEAARISAT
ATCGEEPEGARPRPELYCKLVGGPIASTTGHTIQGQYCDYCNSGDPNKAHPITNAIDGTE
RWWQSPPLSLGLQYNKVNVTLDLGQLFHVAYVLIKFANSPRPDLWVLERSVDYGRTYLPW
QFFAHSKVDCWEQFGTEANIPITEDNDVICTTEYSRIVPLENGEVVVSLVNGRPGAKNFT
FSPTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGRCVCNGH
AEVCRAKGPENLFQCECQHNTCGESCGHCCAGYHQKQWRPATAERTNECEACNCHGHAMD
CFYDPDVERLNGSLNIHGVYEGGGVCINCQHNTAGVNCERCIQGYYRPYDVPVEAPHGCM
PCSCNPEYTDGCEQGTGRCFCKSNFQGENCEHCAEGFYNFPFCQRIPFYPVSTPRPEAST
AVGEIKGGCPPGFFGPQCLACQCYGIGASPGDCDRETGQCFCQPGFRGFSCEECAVGYFR
YPFCQRCECNSVGVVSEICDFQGKCLCRFGVDGPKCDSCSSGFYSFPACQECNCDPLGSQ
DGACGPRGQCRCYPNYAGLSCNQCAPEYYSYPSCFACQCSPLGSYQTTCDPVTGQCECRT
GITGQLCDQCLSGASDFPHCQGFSSECNPLGTIDSSSGYCQCQLYVKGPTCSICKPLYWN
LAGENPDGCSECQCDVTGTLSGVGECEQREGECYCKPHVCGGSCNTCEEGYFALEDSNYF
GCRGCQCDIGGSVSFMCNDLSGACQCRGHVMGQSCQQPEDNYYFPDLHHMKFEIEDGMTP
NGRQVRFGFSPSEFPDFSWRGYAQMTPVQNEVMITLNVEKSNQYLFRAVLRYINPGTETV
FGHITIYRSRSKEGAVQSKEIVFLPSKEPAFVTVPGNGFSDAFSLTPGTWTVNIKAEGIL
LDYLVLLPSDYYEASILQLPVTEPCAYSGPIEENCLLYQHLPVTGFACALACEADRFLLN
GMPRVLVTRKPTPELPIMADISGREVELHLTLSIPQADHYVIVLEYTNEGDQLYVADVFV
NSPSPSPAGRVNIYSCKYSFLCRSFVVDDLNRVAVYELLADARIQLKAHLAHFLLHQVCI
IPVGEFSTEYVKPSVHCIASYGRFVNQSSSCVLLAHETPPTALVLDALSGGMLPFMPSPS
ESVFQGIILKSPQNQVTLSGRVPHPGQYVFIVHFCQPDHPTFPAQVVVEGGQLWSGTFSA
SFCPQVFGCRNLVTAESQTNLDLHEPDFSVTVRVPDGKSLMLGQVLVVPAENYGYHMLHK
KSVDKSFDFINNCGGNSFYIDPLTSSRFCKDSARSLVTFYNNGALPCNCHAMGAVSPTCN
PERGQCQCRPNVIGRQCTRCQTGYYGFPFCKLCHCGQRLCDETTGKCICPPRTVKPQCEV
CEKQSFSYHPLVGCKGCNCSRIGALSAPECDRNNGQCRCKPRIIGRQCDHCASGFYRFPE
CIPCNCNRDGTEPGVCDPWTGVCLCKENVEGAECNVCQKGSFYLDPTNPKGCTSCFCFGI
SDHCHSTNKRRAKFVDMIGWRLQTADQMDIPVTFNPGSNSVVADVQELPSSVHSVYWIAP
PSYLGDKISSYGGFLTYQVKSFGLPSEGMILLEKRPDVQLMGQQMTIVYLDPNNPLPDRR
YYGRVQLVEGNFRHVSSNNQVSREELMMVLSRLDGLHIRGLYFTETQRLTLGEVGLEEVT
STGSGSIAYNVEMCSCPPDYTGDSCQGCTPGYYRDNKGFYTGRCVPCNCNGHSNRCQDGS
GICINCQHNTAGANCERCKEGYYGDALQGSCRVCPCPHTNSFATGCVVNGGNVKCSCKPG
YVGAQCERCAPGYFGNPQKFGGSCQPCNCNNNGQLTSCDPLTGDCINQEPKDGGPEECDD
CDSCVTTLLKDLGTMSDELRLVKSQLQSTTTSAATLEQMKHLETQTKDLRNHLLNYQSAI
SSHGSKVDALEKDLNSLNQDFETLQEKVQINSRKAQTLYNGVAQTNQNANQLDTKIQNVI
RDVHVLLKQISGTDGDGNTLPSGDFSRKLAEANRMMKEMRNRDFSQQLRKAEAEKREAQL
LLNRVQSSLKNHQAENQELVKIVRDSLNEYEAKINDLRKALQEATLQTKLANGLNQANGR
ALEDIKRRINEMSSLQSEFTKYLTTAESSLSQTNSVLQLMKKSQEGYEKLASSLNEVRQE
LSDKVKDLSRSSSKESLVVEAENHAQSLQKLAKQLEEIKRNTSGDELVRCAVDAATAYEN
IINAVKAAEDAANKAVSASDSALQTVVKGDLPGKAKILSSNSDNLLREAKTTQNRLHQDI
SPALDSLRDTLDVVTTKKGLIQTDLTTVRDDLRSINQDDIDSMTSNAKSLIRSANDITNS
VLDGLNPIQTDVERIKDTYGSAQSEDFNEALSDANNSVKTLTSKIPDLLSKIQSINQQLL
PLGNISDNVDRIRELIQQARDAANKVAIPMRFNGKSGVEVRLPSDLGDLKGYTSLSLFLQ
RPESREDGGDEDMFVMYLGNKDASKDYIGMAVRDGKLVCVYNLGDQEAETQMDSILTKSI
TQEAVMDRVKFQRIFQFAKLSYFKEATSHKPKPPDFYDMDSGSGDVLLNLDPENVVFYVG
GYPPNFKLPRELKYPPYKGCIELDDLNENVLSLYNFKKTFNLNTTEVEPCRRKKEESDKN
YFEGTGYARVPTQPSTPFPNFLQTIQTTVDEGLLFFAEHQDFFISLSMEKGSPVLRYKLN
SEPPKERRNRVLINDGTDQMITIRMGKTQKLLRITVNQSVIEVQGEIFNFDTYYLGGIPI
SLREKFNISTPAFRGCMKNLKKTVGVVRLNDTVGVTKKCSEDWKLVRTASLSREGQLSFI
DMGLPDPNNFQSSFGFQTFQPNGMLLRHQIGTNSLQISLEDGHIELSSRDCGTLLKSPQT
YMDGLLHYVSVIRDDTGLSLLIDDESLRDNQRLRIFPDSQQSLRFGGSDFEGCITNVFFQ
RLAQSPEVLNLVSHTRREKEKVSLGVCNLNKPPFLLLLKNSTKISTPRAFNIDRLQGDMR
PASLMKKEVQTNTQHCIESAQSQTFKGAYQFGDSPSSHLVYTFPNEMLKDSYRSQFAVDI
RTTSSASGLMFFAGSKSSSVVLYIAKGRIVFLLRAEGKKLRLKTKEKFNDGKWHTVMFGH
EGRKAHLVLDGLKAQEGSLAGDTIFPIKPPLIYLGASPRVKLKSLPKSSFVGCLRNFKLD
GKALDTPSQNFGVAPCLGGPLEKGVYFSQEGGHISFDDSWMQGKEFEIVVSIRPRSLNGI
LMHFGRHPGQHLSVYMEEGKVTASVDSGAGEMLTSVTPKQSLCDGQWHSVAVTLKENLLQ
LDLDTDSNYETGELPSLPASIQQPLYLGGIPANLTTLKLPVQKPFFGCMKKVMINSVAVS
VTKASEVQGAVSLNGCPVY
NT seq 10320 nt   +upstreamnt  +downstreamnt
atggccagggtacggaaagggagcccagcagctgcttctgcgccccggtggctcccgcgg
cttttactcctcctgctgtcccccctttccgcagccgccgtttctcccgacccggacgcc
ggcttcagccttcaccccccctatttcaatctggccgaggcggctaggatctcggcaact
gccacctgcggggaagagcccgagggcgcgaggccccggcccgagctctactgcaagctg
gtggggggccccatcgcctccaccacgggccacactatccagggccagtattgtgactac
tgtaactctggggatcccaataaagctcacccaataaccaatgcgattgatgggactgaa
cgttggtggcaaagccctcctctgtctttgggcctacagtacaacaaagtcaatgttacc
ttagatctgggacagcttttccatgtggcctatgtgctcatcaaatttgctaattctcct
cgtcctgatctctgggtcctggaaagatcagtagactatggaagaacttacttgccttgg
cagttttttgctcactctaaagtagactgttgggaacagtttgggacagaagccaacata
cctatcactgaagacaatgatgttatctgcaccactgaatattctcggattgtaccactg
gaaaatggagaggtcgtggtttctttagtaaatggtcgtccaggagcaaaaaattttaca
ttctctcctactctgagagagtttacgaaggcaaccaacatccgcttgcgttttctccgg
accaatacccttctgggacacctgatctctaaagcccagcgagacccgacagtcactaga
aggtattattacagcataaaggacatcagcattggtggacgatgcgtctgcaatggccat
gcagaagtgtgcagggccaaaggtcctgaaaacctgtttcagtgtgaatgccagcacaat
acctgtggggagagctgtggccactgctgtgcaggctaccaccagaagcagtggcggcca
gcaacggctgagaggactaatgagtgtgaagcttgcaactgccatggtcatgccatggac
tgtttctatgatcctgatgttgagaggcttaatggaagtttgaacatccatggtgtttat
gaaggtggaggggtctgcattaattgtcagcacaacacagctggtgtaaactgtgaaagg
tgcattcaaggttattaccgtccttacgatgttccagtagaagcaccccatggctgtatg
ccctgcagctgtaacccggagtatacagatggctgtgaacagggtaccggtcgctgcttt
tgcaagtcgaatttccagggggaaaactgtgagcactgtgcggaaggattctacaacttc
cctttctgccagcgcattcctttttatcctgtttctactccaagaccagaagcttctact
gctgttggagaaataaaaggtggttgtccaccaggattctttggacctcagtgtctagct
tgtcagtgctatggcataggagcatcacctggggactgtgacagggagaccggacagtgc
ttctgtcaacctggatttcgtggtttctcttgtgaggagtgtgccgttggatatttccgc
tatcccttctgtcagagatgtgaatgtaattcagtcggtgttgtctctgaaatatgtgat
ttccaggggaagtgtctttgccgctttggagttgatggccctaagtgtgacagctgtagt
tcaggtttctactcttttcctgcttgtcaggagtgtaactgtgacccacttggctcccag
gacggtgcatgtggacccagaggccagtgtcggtgctaccccaattatgctggcctgagc
tgcaaccagtgtgctcccgagtactacagttaccccagttgctttgcttgtcagtgttca
ccccttggttcataccagactacatgtgatccagtcactgggcaatgtgaatgccgaacg
gggattacaggacagctatgtgatcagtgcctttcaggagcctctgatttcccccactgt
caaggtttcagtagtgagtgtaaccctcttggtactatcgattccagttctgggtattgc
cagtgccagctttatgtgaaaggtcctacctgcagcatctgcaagccattatactggaat
ctggcaggcgaaaaccctgatggatgttcagaatgccagtgtgacgtaactggaacatta
agtggagttggagaatgtgagcagagagagggtgaatgttactgtaagcctcatgtctgt
ggtggttcttgtaatacatgtgaagagggctattttgctctggaagacagcaattacttt
gggtgccgagggtgccagtgtgacattgggggatctgtcagctttatgtgcaatgacctt
tctggagcctgccaatgtaggggacatgtcatgggccagtcatgccaacagccagaagac
aattattatttccctgatttacatcacatgaagtttgaaattgaagatggcatgacacct
aatggaagacaggttcgatttggcttcagtccttcggagtttcctgatttcagctggcga
ggctatgcccaaatgaccccagtacagaatgaagtgatgataacattgaatgtggagaaa
tcaaaccaatacttatttcgtgctgttctgagatatattaacccaggaactgaaacagtg
tttggtcacataactatttatcggtcccgttctaaggaaggtgctgttcaaagcaaagag
attgtcttcctgcctagcaaagagccagcttttgtcactgtcccaggaaatggtttttca
gatgctttttccctcactccaggaacttggactgttaatataaaggctgagggcatcctc
ctggattacttggtgctactacccagtgattattatgaagcttcaatcttgcagttacca
gtcacagagccatgtgcctattcaggacctattgaagaaaattgcttgctttatcagcat
ttaccggtgaccggatttgcctgtgccttggcttgtgaagcagatcgcttcctgcttaac
ggaatgccgagagtcttggtgactcggaagcccacgccggagcttcccatcatggctgac
atcagcgggagagaggttgagttacatctgaccctgagcattcctcaagctgaccactac
gtgatagttctcgaatataccaacgaaggtgatcaactctatgttgctgacgtgtttgtc
aacagcccaagtccttcaccagcaggtcgagtgaacatatatagctgtaaatacagcttc
ctctgccggagttttgtggtggacgacctgaaccgtgttgctgtgtatgaactcttagca
gatgcaaggatccagctgaaggcacacttggctcatttccttctgcatcaagtttgtatt
ataccagtgggagaattctctacggaatatgtgaaacccagtgtacactgcattgccagt
tatgggcgatttgttaatcaaagttcctcctgtgtccttttagcacatgaaactcctcca
acggctttggttttggatgcactaagtggtggaatgcttcccttcatgccctcaccctct
gaatctgtgttccagggcatcatcctgaagtcgccacagaatcaagttaccttgagtgga
agagtgccacacccgggccagtatgtcttcattgtccatttttgtcagccagatcatccc
acatttcctgcacaggtggttgtagagggagggcagctgtggtcaggtactttcagtgcc
tctttctgccctcaagtgtttggctgccggaatttagtgactgcagagagtcagactaac
ctggacctccatgaaccagacttctcagtgaccgtgagggttccagatggaaaatccttg
atgctgggccaggtcctagttgttccagcagagaactatggctaccacatgcttcataag
aagtcagtggacaagtcgtttgattttatcaataattgtggaggaaacagtttttacatt
gaccctctgacatcatcgagattctgtaaggactctgcccgctccctggtcaccttctat
aacaatggagccctaccttgcaattgtcatgcgatgggggccgtgagccctacatgtaac
ccagagaggggacagtgccagtgccgacccaatgtcattggtcgtcagtgtacccgatgt
caaactggctactatggttttccattctgtaaattgtgccactgtggccagcgcctttgt
gatgagacgactggaaagtgcatctgcccccctcgcacagtcaagcctcagtgtgaagta
tgtgaaaagcagtccttcagttaccacccattggttgggtgcaaaggctgcaactgctcc
aggataggagctctaagtgccccggagtgtgacagaaacaatggacagtgcagatgcaag
ccccgaataataggacgtcagtgtgatcactgtgcttctgggttttaccgtttccctgaa
tgtattccttgcaattgtaaccgagatgggactgagccaggagtatgtgatccatggaca
ggtgtatgcctttgtaaggaaaatgtagaaggtgcagaatgtaatgtttgccagaagggg
tcattttacttggaccccaccaatccaaagggatgtaccagctgcttctgttttggaata
agtgaccactgtcatagtacaaataagcggagagctaagtttgttgacatgataggttgg
cgcctgcagacagcagatcaaatggacatccctgtcacgttcaacccaggcagtaacagt
gtggttgccgacgtccaggagctgccttcctcggtccacagcgtgtactggattgcgcca
ccatcctatttgggggacaagatttcttcatatggtggcttcctgacttaccaggtaaaa
tcctttggcctacccagtgaaggcatgattctcctggagaagagacctgatgtgcaactt
atgggacagcaaatgactattgtctacttggacccaaacaaccccctgccagaccgacgg
tattatggacgagttcagctggttgagggaaacttcaggcatgtcagtagcaataaccag
gtatctagagaagagctgatgatggtcctgtctagactggatggcttacacatcagaggc
ctttattttactgagactcagcggttaaccctaggtgaggtgggtctggaagaagtcacc
agtacaggaagtggaagcatcgcatacaatgtagagatgtgctcctgcccccctgactat
actggtgactcatgccagggttgcacccctggatattaccgggacaacaagggtttctat
actggacggtgtgttccctgcaattgtaatggacattcaaatcggtgccaggatggttca
ggaatctgtattaactgccaacataacactgctggtgcaaactgtgagcgatgtaaggag
ggttactatggagacgccctccagggttcctgtcgggtctgcccatgccctcatacaaac
agttttgctactggctgtgttgtgaatgggggaaatgtgaaatgttcctgcaaacctggc
tacgtgggagcccagtgtgaaagatgtgcaccaggatattttgggaatccccagaaattt
ggaggtagttgtcagccctgcaattgcaataataatggccagttgaccagctgtgatcca
ttgactggagattgtatcaatcaggaacccaaagatggaggccctgaagaatgtgatgac
tgtgatagctgtgtgacgactctcctgaaagacctgggaacgatgagtgatgagcttcga
ctggtcaaatctcagctccagagtaccactacaagtgctgccactctggagcaaatgaag
cacttggaaacccagaccaaagacctgaggaatcacttgctcaactaccaatctgccatt
tcaagtcacggatcaaaagtagatgccctggaaaaagacctgaacagtctgaatcaggac
tttgagaccctgcaagaaaaggttcaaataaattcaaggaaagcacagacgttgtataac
ggtgttgctcagacgaaccaaaatgcaaaccagctcgacaccaagatacaaaatgtcatc
agagatgttcatgttctcctgaaacagatctctgggacagatggtgatggaaacaccttg
ccctcgggtgacttttccaggaagctggccgaagctaaccgtatgatgaaagagatgaga
aatcgagacttcagtcagcaactgagaaaagcagaagctgaaaaaagagaggcacagctc
ttgttgaatcgtgttcagagtagcctgaaaaaccaccaggcagagaaccaggaacttgtg
aaaattgtacgagattctctaaatgaatatgaagccaaaatcaatgacctccgcaaagct
ctgcaagaagcgaccctccaaacaaagctagccaatggtctcaaccaagctaatggtcga
gccctggaagacattaagagacggattaatgagatgagctccctacaaagtgaattcact
aagtatctcaccactgctgaatcatctttgtcacagaccaacagcgttctccaattgatg
aagaaaagccaagagggatatgagaagttagcttccagtttaaatgaagtgaggcaagaa
ctgagtgacaaagtgaaagatctttcccgatcgtctagcaaagaatctctagtggtggag
gcagagaatcatgcccagtctttacagaagttagcaaagcaattggaagaaatcaagagg
aacaccagtggtgatgagttggtgcgctgcgctgtagatgctgccacggcctatgaaaac
atcatcaacgcagtgaaagcagctgaggatgcggccaacaaggcagtgagcgcatcggac
tctgccctacagactgtggtgaagggagacctgcctggaaaagcaaagatattgagctcc
aacagtgataatctactaagggaagcaaagaccacacaaaatagattacatcaagacatc
agtccagctctggacagcctgcgagacacgttggatgttgtcacaacaaagaagggcttg
atacagacggaccttaccactgtccgagatgatcttcgtagcataaatcaagatgacatt
gacagtatgaccagcaatgcaaagagtctgatcagaagtgcaaatgacatcacaaacagt
gtgctggatggtctgaaccccattcagacagatgtggaaagaattaaggacacgtatgga
agtgcacagagtgaagactttaatgaggctctgagtgatgcaaacaattcagtgaagaca
ttaaccagcaagataccagatctcttaagcaagattcagagtatcaaccaacagctcttg
ccactgggcaacatctctgacaatgtggaccggataagagagctcattcagcaggccaga
gatgctgcaaataaggttgctattccaatgaggttcaatggcaagtctggtgttgaggtt
cggctgccaagtgaccttggagatttgaaagggtacacatctctctctttgtttcttcaa
agacctgaatccagagaagatggtggggatgaagacatgttcgtgatgtacttgggcaat
aaagatgcttcaaaggactacataggcatggcagtaagggatggcaaacttgtttgtgtc
tataacttgggagaccaggaagctgaaacccaaatggactccattttgaccaagagtata
actcaagaggcagttatggatcgagtgaaatttcaaaggatcttccagtttgcaaagctc
agctactttaaagaagccacatcccataagcccaagcctcctgatttctatgacatggat
agtgggagcggcgatgttcttctgaatttggaccctgaaaatgttgtcttttatgttgga
ggctacccacccaatttcaagcttcctcgtgaactaaaataccctccctacaagggctgc
attgaattagatgacctcaatgaaaatgttctaagcctgtacaacttcaaaaagactttc
aatctcaacacaacagaagtggagccctgtagaaggaaaaaggaggagtctgacaaaaat
tattttgaaggcacaggctatgcccgggttccaacccaacccagcactccttttccaaac
tttctacagacaattcagactactgtcgatgaaggcttattgttctttgcagaacaccag
gatttcttcatatctttaagtatggaaaagggatctcctgtgttgcgatacaaactaaat
tcagagcctccaaaggagagaagaaatcgagtactcataaatgatggaactgatcaaatg
attactatcagaatggggaaaacccaaaagcttctacgaataactgtgaatcaatctgtc
attgaagttcagggtgaaattttcaattttgatacctattatcttggaggaattccaatc
tcactccgggaaaagtttaatatatccactcctgctttccgaggctgcatgaaaaatctg
aagaaaactgttggagttgttaggttgaatgataccgtaggagtaaccaaaaagtgctca
gaagactggaagcttgtacggacagcatcactctccagggaaggacagctaagtttcatt
gacatggggctgccggaccccaacaactttcagtcttcgtttgggtttcagaccttccaa
cccaatggcatgttattaaggcaccaaattgggacaaatagcctacaaatctctctggaa
gatggtcacatcgaattaagctctagggattgtggcactcttctgaaatctccccagacg
tatatggatggtttactgcattatgtgtctgtaataagagatgataccgggctaagtctt
ctgattgatgacgagtctctaagagacaaccaaaggcttcggattttcccagactcacag
caatccctacgctttggagggagtgattttgaaggatgtatcactaatgtatttttccag
aggttagcacagagtcctgaggttctcaatttagtcagtcatactcggagggaaaaggag
aaggtgtccctaggagtctgcaacttgaataagccaccttttctactgctgctgaaaaac
tcaacaaagatcagcacacccagggcattcaacattgatcggctacaaggggatatgcgt
cctgcctccctgatgaagaaggaggttcagacaaacacccagcactgcattgagtcggct
cagtcccagacttttaaaggagcttatcagtttggagacagtcccagtagccacttggtg
tacacattccctaatgagatgctgaaagacagttacagatcacagtttgctgtggatata
cggacaacttccagtgcttcaggactgatgttttttgcagggagtaagagctcctcggtg
gtgctttacattgcaaagggacgcattgtctttttactgagggcggaaggaaagaagtta
agactgaaaaccaaagagaaattcaacgatgggaagtggcacacggtcatgttcgggcat
gagggaaggaaggcccatcttgttttagatggtctaaaagcccaggaaggaagcttggct
ggggatactatctttcctatcaaaccaccgctgatttacctgggggcctctcctagggtg
aaactgaagagcctccccaagagcagctttgtgggatgcctgaggaactttaagctggat
ggaaaggccttggacaccccctctcaaaactttggggtagccccctgtttgggtggccct
cttgagaaaggagtgtatttctcccaagaaggcgggcacatcagctttgatgactcctgg
atgcagggaaaagaatttgaaatagttgtcagcattcgtcctagaagcctcaatggaatc
ttaatgcattttggaagacaccctgggcagcatttaagtgtttatatggaggaaggaaag
gtcactgcttctgtggacagtggggctggtgagatgctgacatcagtcacacctaagcaa
tctctatgtgatggacagtggcactcagtagcagtcactctaaaggagaatttgctgcag
ctcgacctggacacagatagcaactatgagactggagagctgcctagcctgccggccagc
atccaacagcctttgtatttgggaggcatcccagccaacttgacaacactgaagctgcct
gtacaaaaacccttctttggctgcatgaagaaggtcatgatcaacagtgtagctgtctct
gtcactaaggcctcagaagtccagggagctgtcagtctgaatggctgtcctgtctactaa

KEGG   Phascolarctos cinereus (koala): 110196697
Entry
110196697         CDS       T05867                                 

Gene name
COL4A2
Definition
(RefSeq) collagen alpha-2(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04926  Relaxin signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04974  Protein digestion and absorption
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110196697 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110196697 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110196697 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110196697 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    110196697 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110196697 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110196697 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110196697 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110196697 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110196697 (COL4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110196697 (COL4A2)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110196697 (COL4A2)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110196697 (COL4A2)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110196697 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110196697
NCBI-ProteinID: XP_020825719
UniProt: A0A6P5IU83
LinkDB
Position
Unknown
AA seq 1704 aa
MGRRMDPTARVDLRRCLLLFVLMVVLTERAHAGVKKYDVPCGGRDCSGGCQCYPEKGARG
QPGPVGPQGYSGPPGLQGIPGLQGRKGDKGERGAPGITGPKGDVGQRGVSGFPGADGIPG
HPGQGGPRGRPGSDGCNGTTGDAGTQGPPGSGGLPGLPGPQGPKGQKGEPYAFSQADRDR
YRGDSGEPGFIGLPGPPGYPGSPGKIGPVGAPGRPGPPGPPGPKGQAGNRGLGFYGEKGE
KGDIGRPGPTGIPSEGEVSVIITENVLEQMDQYKGEKGDQGEPGWKGLSEKGEEGIVGFP
GPRGLPGLSGAKGEPGDKGLRGADGFPGSDGYKGPPGDIGDRGPPGPPSYSPHPSLIKGI
RGDPGDAGARGPDGSPGQQGDPGLPGPQGRTEGDGDEQRGLPGEMGAKGFIGDPGFPALY
PGPPGTDGKPGLRGPPGPAGPPGPDGFLFGLKGAEGRVGYPGPSGFPGTRGQKGWKGDPG
DCKCDLPSGLPGLPGPIGHPGANGEPGRKGEIGDPGPHGIPGFSGFKGNPGIPGLPGPKG
QKGDSREITTKGSRGDQGNPGVPGLQGEDGFPGQDGLDGFPGLPGLPGDGIKGLPGDPGF
PGISGLKGIAGEIGPPGLGLPGPKGERGFPGDPGLSGSPGFPGPPGPPGAPGQTDCDGAV
KQPVGQEIIQPGCVIAPKGSPGLPGLPGPPGAKGQRGIPGFPGADGFIGLKGFQGDGGRE
GYPGPPGFVGPRGSKDATGLPGLDGSPGTTGLPGAVGPAGQKGLPGEVLGAQTGLPGDPG
LPGIPGLKGEPGNRGPQGFRGSPGMPGMPGLKGQPGFPGPSGQPGLPGPPGTHGFPGPQG
QEGLPGLPGPSGFAGLPGDRGDRGDVGVPGPVGMKGLDGDRGDTGFIGEQGRRGEPGFQG
IPGMPGIPGTKGFKGSPGMEGFKGMLGIKGRPGIIGYKGEVGDFGIPGLKGLTGEPGLKG
SRGEPGPPGAPPKFLPGMKDFKGEKGDEGPVGGKGYWGTKGGQGMPGIPGQAGIPGLPGV
PGYIKGAKGEIGVPGVPGLQGFPGITGSPGIRGFPGFVGIRGDKGMPGREGLFGETGSIG
DTGDEGDTINLPGRPGLKGELGISGLAGEKGFTGEKGTPGDQGFIGLMGIKGSQGLLGLK
GQTGFPGLTGLPGSQGDPGHAGPPGEKGDSGWPGVPGLSGFPGIRGLSGLHGLPGTKGLP
GSPGADGYGNLGFPGPFGDKGERGEPNTIPGPLGAPGQKGERGTLGAQGPSGSPGIQGFP
GFTAPSNISGLPGDKGAPGLFGLQGYRGPPGAPGPSSSPGIKGEVGSPGLPGERGPKGWA
GDPGPQGRPGVYGLPGEKGPKGQQGLMGYHGIPGNVGDRGPKGPKGDRGFPGTPGAVGSP
GIPGVPLRIATEPGVAGPHGRSGPPGIQGEMGPQGPPGDPGLRGLPGKPGPQGRGGISAL
PGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCPVGM
NKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCHYASRNDKSYWLS
TTAPLPMMPVAEEEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSFLMH
TAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQASP
SADTLKAGLIRTHISRCQVCMKNL
NT seq 5115 nt   +upstreamnt  +downstreamnt
atgggcagaagaatggacccaactgccagagttgaccttcggcggtgtctgctgctattc
gtgctgatggtagtgctaactgagagggcacatgctggtgtgaaaaaatacgatgtgccc
tgtggtggaagagactgcagtggaggttgtcagtgctatcctgagaaaggagcccggggt
caaccaggaccagttgggccgcaagggtacagcggaccaccagggctacaaggtattcct
ggattacaaggacgcaaaggtgataaaggtgaacgtggagcaccaggaataacagggccc
aaaggagatgtgggacaaagaggtgtttctggatttcctggtgctgatggaattcctggt
catcctggtcaaggtggaccccggggaagaccaggcagtgatggttgcaatggaaccact
ggagatgctggtacacagggacccccaggttctgggggtttacctgggctccctggaccg
caaggacccaaaggtcagaaaggtgaaccttatgcattttctcaggctgaccgagataga
tacaggggcgattcgggcgaacctggttttatcggtttaccaggtcctccaggttatcct
ggcagtccaggaaaaattggtcctgttggagcgcctggacgaccaggacctcctggaccc
ccaggaccaaaaggacaagcaggcaacagaggccttggcttttatggcgaaaagggtgaa
aagggtgatattgggcggcccggacccactggaattccatcagagggtgaagtttctgtt
atcattactgaaaatgtgctggaacaaatggatcaatataagggtgaaaaaggagaccag
ggagagccaggctggaaaggactgtcagaaaaaggtgaagaaggaatagtgggctttcca
ggaccccggggtttgccaggtctcagtggtgcaaaaggagaaccaggagacaaaggatta
agaggagctgatggatttccaggaagtgacggctataaaggaccaccgggagacataggt
gaccgaggtcctcctgggcctccttcatattcaccccacccctctctaataaaaggaata
agaggtgatccaggagatgcaggggctcgtggccctgatggaagtccaggtcaacaagga
gaccccggcctgccaggtccccagggcagaacagaaggagatggagatgaacaaagaggc
cttccaggtgaaatgggagccaaaggtttcataggtgacccaggttttccagctctatac
ccaggccctccaggtacagatggaaaaccaggacttcgaggaccacctgggcctgctggg
ccaccaggaccagatggatttctttttgggcttaagggagctgagggaagggtgggttac
ccaggcccttcaggattcccagggacacgaggacaaaaaggatggaaaggtgaccctgga
gactgtaaatgtgatcttcccagtggccttcctggtctaccaggacctattggtcatcct
ggtgcaaatggagaacctgggaggaaaggggaaattggtgacccaggcccacatggtatt
cctggtttctcgggcttcaagggtaaccctggcattcctggattacctggacctaaagga
cagaaaggagattctagagaaattacaacaaaaggtagtagaggtgatcaaggcaatcct
ggcgtacctggtttgcaaggtgaagatggctttccagggcaagatgggctagatggtttt
ccaggccttccgggtcttcctggtgatggcatcaaaggccttccaggagatccaggtttc
ccaggaatatctggtttaaagggcattgcaggagaaattggtcctccgggcctaggtcta
ccaggccctaaaggtgaacgaggtttccccggtgaccctggattaagtggaagtcctggc
ttcccaggccctccaggccccccaggtgctccaggccaaacagattgtgatggagctgtg
aaacaaccagttggccaggagataatccaaccaggttgtgtaatagcacctaaaggatct
ccagggctgcctggactaccaggacctccaggtgctaaaggtcaaagagggattccagga
ttcccgggtgcagatggatttattgggctcaaaggattccaaggagatggaggtcgtgaa
ggttatccaggcccaccaggatttgttggacccagaggatccaaagatgcaacagggctc
cctgggctggatggaagcccaggaactacaggactaccaggtgctgtaggaccagcagga
caaaaaggactacctggagaagtattaggtgcacagactggtctcccaggagatcctgga
ttgcctggaatcccagggctgaaaggagaaccaggaaacagggggcctcaaggatttaga
ggaagcccaggtatgcctggaatgcctgggttgaagggtcagcctggattcccaggtcct
tcaggtcaacctggattaccaggacctcctggaacacatggctttccaggccctcaaggc
caagaaggactaccaggtctcccaggcccttcaggatttgcaggtctacctggtgataga
ggagatcgaggtgatgtaggcgtccctggccctgtggggatgaaaggtctggatggtgac
agaggtgatactggttttataggagagcaaggcagaagaggagaacctggatttcagggg
atacctggaatgcctggcatcccaggaacaaaaggtttcaaagggtctcctggtatggaa
ggtttcaaaggcatgttgggtatcaaaggaagaccaggaatcattggatataaaggagag
gttggcgattttggaattcctggtttgaaaggtctaactggtgaaccaggcttgaaaggt
agccgtggagagccagggccaccaggagcacctccaaaattcctgccaggaatgaaagac
ttcaaaggggagaaaggagatgaaggacctgttggtgggaaaggatattggggcacaaaa
ggtggacaaggaatgccaggcattcctggacaggcaggaattcctgggttacctggggtg
cctggttacatcaaaggggccaaaggtgaaattggtgttcctggagtgcctggtttgcaa
ggattccctggaataactggttctcctggtattagaggctttcctggatttgtaggtatt
aggggtgacaagggtatgcctggacgagaaggtctttttggtgagactggaagtatagga
gatactggtgatgagggagacactataaacttaccaggaaggccaggattgaagggagaa
ctgggcatatctggacttgcaggtgagaagggcttcactggagaaaaaggcacacctgga
gaccaaggtttcataggattgatgggcataaaaggatctcaaggccttcttggactgaaa
ggacagacaggtttcccaggactgacaggactcccaggatcccaaggggacccaggtcat
gctggccctcctggtgaaaaaggagattctggatggccgggagttccaggcttgtcaggt
tttcctggcatcagaggactcagtggactacatggcttaccaggcactaaaggcttgccc
ggatctccaggtgcagatggctatgggaatcttggcttccctggtccttttggtgacaaa
ggagagagaggagagcctaacacaattccaggacccttgggagcaccagggcagaaagga
gagagaggaaccctaggggcacaaggtccttctggtagcccaggaattcaagggtttcca
ggattcaccgcaccttccaatatctctgggttaccaggtgacaaaggagcaccaggtcta
tttggtttacagggttaccgaggccccccaggagcacctgggccatcatcttcccctgga
atcaaaggagaagtaggaagtccaggacttccgggagaaaggggacccaaaggatgggca
ggagatcccggaccccaaggcagacctggagtgtatggactcccaggagaaaaaggacct
aaaggacagcaaggactcatgggataccatgggataccaggaaatgttggtgacagaggc
cccaagggacccaaaggagacagaggattccctggcactcctggtgctgtaggatctcct
gggattccaggagtccccctgaggattgccacagaacctggggtggcaggtccccatgga
aggagtgggccccctggaatacaaggagagatgggtccccagggccctccaggtgatcca
ggtttacgaggactacctggaaaaccaggaccccaaggaagaggtggtatatcggccctt
ccaggattcagaggtgaccaaggtcccatgggtcatcaaggaccagtaggccaagaaggt
gaaccaggacgaccaggaagtcctgggctacctggcatgccaggccgcagtgttagcatt
ggttatctcctggtgaaacacagccagactgatcaagagccaatgtgtccagttggaatg
aataaactctggagtgggtacagtctgctgtactttgaaggccaggaaaaagcacacaac
caagaccttggactggctggctcgtgcttggctcgtttcagtaccatgcctttcttgtac
tgcaaccctggagacgtctgccattatgccagccggaatgacaagtcctactggctctca
acaactgcaccgctgcccatgatgcctgtggcagaagaggaaatcaaaccctacatcagc
cgctgctctgtatgtgaagcccccgccgtggccattgctgtgcatagccaagatgtctcc
atcccccactgtcccgcagggtggcgcagcctgtggattggctactcctttctcatgcac
actgcggctggggatgagggtggtggacagtcactggtatctcctggcagctgtctagaa
gacttcagagccacacctttcattgaatgcaatgggggccgaggaacctgccactacttt
gccaacaaatacagcttttggctcaccaccattccagagcagaacttccaggcctccccc
tctgcagatactctcaaggcggggctcatccgaactcacatcagtcgttgccaggtctgc
atgaagaacctataa

KEGG   Phascolarctos cinereus (koala): 110196698
Entry
110196698         CDS       T05867                                 

Gene name
COL4A1
Definition
(RefSeq) collagen alpha-1(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04926  Relaxin signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04974  Protein digestion and absorption
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110196698 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110196698 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110196698 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110196698 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    110196698 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110196698 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110196698 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110196698 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110196698 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110196698 (COL4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110196698 (COL4A1)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110196698 (COL4A1)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110196698 (COL4A1)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110196698 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110196698
NCBI-ProteinID: XP_020825722
UniProt: A0A6P5IUD4
LinkDB
Position
Unknown
AA seq 1668 aa
MSPRPVVWLLLLLAALLLNEERSKAAAKGCSGSGCGKCDCHGVKGQKGERGLPGLQGVIG
FPGMQGPEGPHGPPGNKGDAGEPGLPGTKGTRGPPGSSGYPGNPGLPGIPGQDGPPGPPG
IPGCNGTKGDRGPVGPPGLPGFSGIAGPPGLPGMKGDPGEILSLIPGMPLKGERGFPGPP
GPMGPRGNPGLPGMDGPPGYSGPPGPPGPPGLPGEKGQMGLSFQGPKGDKGEQGVSGPPG
EPGQAQIGKKGDFATQGPKGEKGERGVPGVPGERQKGEPGKLGPRGKAGKDGEKGEKGSR
GFTGDQGLPGLQGREGAKGDRGQPGPPGLPGPVISTQPGGEKGEKGYPGAPGLKGEPGQK
GFPGSPGLPGPPGFPVPGQIGAPGFPGERGEKGDQGPPGQSLPGTSGRDGFPGPPGPPGP
PGLPGHTNGIVECQPGPPGDQGPPGSAGLPGLTGEMGEKGEKGQGCLTCDLDGRPGPPGP
QGPPGEIGFPGQPGAKGDRGSPGRNGLEGMPGPPGLPGLRGEPGAKGEPGEIYFDIQLKG
EKGEPGFPGQPGAPGRAGTPGRDGHPGLQGPKGSPGSIGLKGERGLPGGVGFPGSRGDIG
PPGPPGFGLPGPVGDKGQAGFPGSPGSPGLPGPKGEAGTVVPLPGPPGAAGVPGPPGFPG
PQGDRGFPGTPGRQGPPGEKGAVGQPGIGFPGPPGPKGVDGLPGAVGQPGSPGRPGFDGL
PGNPGIPGQKGEPGVGLPGPKGSSGLPGIPGLPGEKGNVGNPGIPGEHGLIGPPGLQGLR
GDPGLQGIQGPKGAPGVPGIGPPGVMGPPGGQGPPGSTGPPGIKGEKGYPGFPGSDMPGP
KGDKGSPGLPGLTGQIGLPGPPGTQGTPGLPGFPGPKGEMGVMGTPGQPGPPGPAGSPGF
QGVKGDQGFPGTTGPRGDPGFKGDKGDAGLPGQPGSMDKVDMDSMKGQKGDQGEKGQTGP
IGDKGARGDPGTPGVPGKDGQAGTPGQPGPKGDQGLGGSPGAPGLPGPKGSVGGMGLPGS
PGEKGAQGIPGSQGIPGFPGLKGEKGVKGEAGRPGIGTPGLPGEKGDPGPSGFPGRPGEK
GEKGSPGMPGMPGPPGPGGSPGNVGYPGSPGMPGEKGDKGLPGLDGIPGVKGDAGQPGLP
GPTGPSGQKGEPGGDGIPGSAGEKGEPGLPGRGLPGFPGSKGEKGSKGELGFPGSAGSPG
IPGPKGEPGFMGPPGPSGQQGLPGVPGRAVEGPKGDRGPQGQPGIPGVPGPMGPPGLPGL
DGAKGEKGNPGWPGSPGVPGAKGDPGFQGMPGIGGTPGITGSKGDMGPPGVPGFQGAKGS
TGLQGLKGDQGDQGFPGSKGLPGPPGPPGPYSLIKGEPGIPGPEGPAGLKGLPGPPGPKG
QQGVTGSAGIPGPPGNPGFDGAPGQKGEPGPFGPPGPKGHPGPPGPDGLPGSMGPPGTPS
VDHGFLVTRHSQTIDDPQCPPGTKIIYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMP
FLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGENIRPFISRCAVCEAPAMVMAVH
SQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT
CNYYANAYSFWLATIERNEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5007 nt   +upstreamnt  +downstreamnt
atgagtccgcggccggttgtttggctgctgctgctgctggctgccctcctgctcaacgag
gagcggagcaaagcagctgcaaagggttgttctggttctggctgtggaaaatgtgactgc
catggagtgaaaggccaaaaaggtgaacgaggtcttccaggattacaaggtgtcattggg
tttcctggaatgcaagggcctgaaggtcctcatggacctccgggtaataagggggatgct
ggagaaccaggattaccaggaacaaaaggaacaagagggccaccaggttcatctggttat
cctggaaaccctgggcttcctggtatcccaggccaagatggtccacctggtcctcctggt
atcccaggatgtaatggtacaaagggtgatagaggtccagtgggtcctcctggtttgcct
ggattttctgggatagcagggccccccggattgccaggaatgaagggagacccaggtgaa
atccttagtctaatcccaggcatgccattgaaaggtgaaaggggatttcctggaccccct
ggaccaatggggccaagaggaaatccaggattgccaggcatggatggtccaccaggatat
tcaggaccacctggtccaccaggtcctccaggacttccaggtgaaaagggtcaaatgggt
ttgagttttcaaggacccaaaggtgacaagggtgagcaaggtgttagtggacctccaggt
gaaccaggacaagctcaaataggaaaaaagggagattttgctactcaaggaccaaaaggt
gaaaaaggagaacgtggagttcctggagtaccaggtgaaagacagaaaggtgaacctggt
aaactagggcctcgagggaaagctggaaaagatggtgaaaaaggagaaaaggggagtcga
ggttttacaggtgaccaaggactcccgggattacaaggcagagagggtgctaagggagac
agaggacaacctggccctccaggcttaccaggccctgtgataagcacacaaccagggggt
gaaaaaggagagaagggatatccaggtgctccaggattaaaaggcgaaccgggtcaaaaa
ggttttccaggtagtccaggcctaccaggtcctccaggcttcccagtcccagggcaaatt
ggtgctcctggctttcctggtgaaagaggagaaaagggtgaccaaggtcccccaggacaa
tcattgccaggaacaagtggaagagatgggttcccaggaccgcccgggcctcctgggcct
cctggcttaccaggccatacaaatggaatagtggaatgccagcctggaccccctggagat
caaggtccaccaggaagtgctgggctacccggattgacaggagagatgggagaaaaaggt
gagaaaggtcaaggttgcctaacctgtgatttagatggacggcctggacctccaggtcca
caaggaccaccaggggaaataggttttccaggacagccaggtgccaagggagacagaggt
tcacctggacgtaatggtcttgaaggaatgcctgggcctccaggtttgccaggactgagg
ggtgagccaggagcaaagggagagcctggagagatttactttgatatacaactcaaaggt
gaaaagggagagccaggttttccaggacaaccaggtgccccaggaagggcaggaacacct
ggaagagatggccatccaggtcttcagggtcccaaaggctcaccgggttcaataggacta
aaaggagaacgtggtctccctggaggagttggatttcctgggagtcgtggtgacataggc
ccccctggcccaccaggatttggcctgcctggtccagttggtgacaaagggcaagcaggt
tttccaggaagccctgggtcaccaggcctcccaggtcctaagggtgaagcaggaacagtt
gttcctctacctggtccccctggggcagcaggagttccaggaccaccaggtttcccagga
ccccaaggtgacagaggttttcctggcaccccaggaagacaaggacctccaggagaaaaa
ggtgctgttggccaaccaggaatagggtttccaggacccccagggccaaaaggtgttgat
ggcttacctggagctgttggtcagcctggaagtccaggtcgtccaggatttgatggttta
ccagggaatccaggtattccaggacaaaagggtgagcctggagtaggtctaccaggtccc
aaaggatcatcaggtcttcctggcattccaggccttcctggtgaaaagggaaatgttggt
aacccaggcatcccaggagaacatggacttataggaccacctgggctacaaggactcaga
ggtgacccagggcttcaaggaatccagggtccaaaaggtgcccctggagtgccaggaata
ggccctcccggagttatgggcccccctggaggacagggaccaccaggatcaacaggtcct
cctggaatcaaaggagagaagggttaccctggtttcccaggatcagatatgccaggacca
aaaggagataaaggaagtccaggtcttcctggcttaacaggccaaatagggttacctggg
cctcctggcacacaaggaactcctggacttccaggctttccaggtcccaagggagaaatg
ggagtaatggggacccctggtcagccaggtcctcctggaccagcgggtagtccaggattc
caaggagtaaaaggtgaccaaggtttcccaggtacaacaggacccaggggtgatccaggt
ttcaaaggtgataaaggtgatgctggtctccctggacagccaggatcaatggataaagtg
gacatggacagtatgaagggccagaaaggagatcaaggagaaaaaggacaaactgggccg
attggagataaaggggccagaggagatcctggcactccaggagtacctgggaaggatgga
caagcaggaactccaggccagccaggtcctaaaggtgatcaaggtcttgggggatcgcca
ggtgctccaggactaccaggaccaaagggttctgttggtggaatgggcttgccagggtca
cctggagaaaaaggagcacaaggaatcccaggctctcaaggtatcccaggcttccccgga
ttaaaaggagaaaaaggagtgaaaggagaagcaggtcgcccaggcattgggactcctgga
cttcctggtgaaaagggagaccctggaccttcaggttttccaggaaggcctggagagaag
ggagagaagggaagcccagggatgccagggatgcctggtcccccggggcctggaggatca
cctgggaatgttggctatccagggagccctggaatgcctggagagaagggtgacaaagga
cttcctggtttggatggcattcctggagttaaaggagatgcaggtcagcctggccttcca
ggtccaacaggtccaagtggccaaaaaggtgaaccaggtggtgatggaattccaggatca
gctggtgagaagggtgaaccaggtcttccaggaagaggacttccaggatttccaggttcc
aaaggagaaaaaggttccaagggcgagttgggtttcccaggatcagcagggagcccagga
atccctggacccaaaggagaaccaggatttatgggtcctccgggtccctcagggcaacag
ggattgcctggagtacctggccgagcagtggagggtcccaaaggagatagaggtccacaa
ggtcaacctgggatacctggtgttcctggacccatgggtcctccaggcctcccaggactt
gatggagcaaaaggagaaaaaggaaatccaggttggccaggatccccaggtgttccagga
gctaagggagacccaggatttcagggaatgcctggtattggtggtacaccaggaatcaca
ggttctaagggtgatatgggacctccaggtgttccaggatttcaaggtgccaaaggttct
actggccttcagggactcaaaggagatcaaggagatcagggattcccaggctcaaaaggt
cttccaggaccacctggtcccccgggtccttacagcctaatcaaaggagagccaggtatc
cctggtcctgaggggccagcagggcttaaaggtcttccaggccctccaggtcctaaagga
caacaaggtgtaacgggatctgcaggtattcctggaccacctggtaacccagggtttgat
ggtgcacctgggcaaaaaggagaaccaggcccttttggtcctcctggtccaaaaggacat
cctggtccaccaggtccagatgggctgccaggttcaatgggtcctccgggtactccctct
gtagatcatggattccttgttaccaggcatagtcaaaccatagatgatccacagtgtccc
cctgggacgaaaataatctaccatggctattctttgctctacgtgcaagggaatgaacga
gcacatggccaggacttgggtacagctggaagttgtctacgcaaattcagtaccatgcca
ttccttttctgcaatattaacaatgtttgcaactttgcatctagaaatgactactcctat
tggctgtctactcctgagcccatgccaatgtcaatggcacctatttctggtgaaaatatt
aggccatttattagtaggtgtgctgtatgtgaggctcctgccatggtgatggcagtccac
agccaaacaatccaaataccacagtgccctaatggatggtcatccctttggattggctat
tcttttgttatgcacaccagcgctggtgccgaaggttctggccaggccctagcatccccc
ggttcctgtctagaagaatttagaagcgcacccttcattgaatgccatggccgtgggact
tgtaattattatgcaaacgcttatagcttctggcttgctactatagaaagaaatgaaatg
ttcaagaagcctactccatcgactttgaaagcaggagaactgcgcacacacgttagccgc
tgccaagtctgtatgagaagaacataa

KEGG   Phascolarctos cinereus (koala): 110197222
Entry
110197222         CDS       T05867                                 

Gene name
COL4A3
Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04926  Relaxin signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04974  Protein digestion and absorption
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110197222 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110197222 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110197222 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110197222 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    110197222 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110197222 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110197222 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110197222 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110197222 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110197222 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110197222 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110197222 (COL4A3)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110197222 (COL4A3)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110197222 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110197222
NCBI-ProteinID: XP_020826600
UniProt: A0A6P5IWW9
LinkDB
Position
Unknown
AA seq 1674 aa
MSPGGASRRVLPMLLPTRLLLLLLIVAAPAVGKGCVCTAKGPCSCDGIKGNKGEKGFPGC
PGTPGQKGLPGPEGIPGPQGPKGSPGFPGFIGSKGTRGMTGLPGFPGPPGLPGSPGNTGP
YGPPGLPGCNGTKGEQGFPGPPGTPGQPGLPGTNGLKGEKGAPAREKGTGNGGRGDPGLP
GIPGRQGLPGPPGFPGPAGPQGPPGFLGFPGEMGPPGPKGHMGVKGIGEKGDQGLRGLTG
PPGPPGAVIVTLTGPDNLTDSKGDKGDKGSVGEPGPPGPKGLPGESYASEKGIPGDPGPQ
GQPGKDGAPGFPGLPGAKGKKGLPGLTGETGVKGFKGDIGPPGFRGPTEYYSGYLEKGND
GAPGPPGPKGERGPRGPRGPPGDIGRPGASRPGLRGTPGFPGIKGHKGERGPPGINIMGP
PGLPGFPGTPGYKGLPGLPGPPGKVTFQNGPPGDHGDPGHVGSPGMPGAYGPKGEEGLLC
TQCTYTPGPPGLPGLPGLDGEKGTQGGQGPDGLKGSPGSPGYTGLPGFPGFPGTPGDQGQ
KGEKGETSHEGEAGDRGDPGNRGDPGKKGSDGIPGKPGTKGLPGTKGEPAVNGEKGDKGF
PGNPGDPGHPGPMGPAGASNYGPPGKPGPKGATGVPGFPGLPGNDGPKGEPGIAEPVPGP
PGPPGLPGLPGLQGTTGKPGSMGPSGNPGPPGSDGEAGFPGIGVPGPPGQRGDRGFPGAK
GSPGCPGEMGEPGSPGIPGLPGAKGDPGTAIPGKPGITGFQGEKGSSGENGEHGLPGLPG
LPGSPGNDGPNGLPGEPGFPGPPGYNGIPGICIPGAKGTQGLPGLNGLRGPQGDRGLDGP
KGDPGIPGLDRSGSPGEPGPPGLPGHQGDKGLVGPTGHPGAPGHPGPPGQKGEVGMMGFP
GTTGPPGMPGNPGAPGYKGSFGIPGRKGKKGLPGAKGERGNKGNQGPSMISADIGEKGEP
GPGGPLGGLGQKGERGTPGLPGLQGHDGMPGRPGLPGLRGDPGTIGHPGEPGPPGGPGSM
GHMGMPGPKGKKGTAGHPGVTGRPGLPGIQGMKGEKGEPGYAKDAQPGPPGPTGEPGPPG
SLGMKGGRGPPGPPGPVGPAGTEGNQGRSGNRGPPGQPGPTGDLGFKGCKGFPGTPGMKG
PPGPPGAPGPPGPMGEKGKQGGDAFPGPSGEKGELGLLGALPGPRGLPGLQGDKGNEGRP
GLPGIYGIKGVMGDVGPIGPIGMTGPPGPPGFPGALIPGQKGNQGPPGLGGNPGDPGPPG
PPCEYTSGIKGEKGFPGDPGPTGPAGTIGDPGPPGHLGMPGTPGFPGFGGDPGFQGFPGM
TGEKGNLGPPGPFGPPGSIGPKGPPGQPGDPGTIKIISLPGSPGPPGQPGDPGMQGEPGP
QGPAGYPGLQGPRGQPGKPGKPGIPGPVGEKGNKGSKGEIGPPGSVGLPGLKGKPGNFGP
PATGSSIRGFIFTRHSQSTEIPSCPRGTVPLYQGYSLLYVQGNEQAYGQDLGTLGSCLQR
FTTMPFLFCNTNDVCNFASRNDYSYWLSTTAQMPMNMAPITGRAVEPYISRCTVCEGPAM
AIAVHSQTTDIPLCPDGWISLWKGFSFVMYTSAGSEGSGQALASPGSCLEDFRANPFIEC
HGRGTCNYYSNSYSFWLASLNPRRMFRKPTPSTVKAGELEXIISRCQVCMKRRD
NT seq 5025 nt   +upstreamnt  +downstreamnt
atgagtcccgggggcgcgtccagaagggtgctgccaatgttgctgccgactagactgctg
ttgctgctactcattgtggcggctcccgctgtgggcaagggctgcgtctgtacggccaag
ggcccatgctcctgtgatggcatcaaaggcaataagggtgagaaaggctttcccggttgc
cctggtactcccggccagaaaggactgcctggtccagaaggtatacctggaccccaggga
cccaagggttctccagggtttccaggctttattggttccaaaggcacaaggggaatgaca
ggattgccaggttttccaggtcctccaggacttcctggtagtcctgggaatactggtccc
tatggacctcctggcttaccaggatgcaatggcacaaagggtgagcaaggatttccagga
cctccagggacaccaggtcagccagggttaccgggcaccaatggattaaaaggagaaaaa
ggagccccggcccgtgaaaaaggtacaggaaatggtggaagaggtgatcctgggttacca
ggaatcccaggacgtcagggtttgcctggccccccgggatttcctgggccagctggacca
caagggcccccaggattcttaggttttccaggagagatgggacctccaggaccaaagggt
cacatgggtgttaaagggattggagaaaagggagatcagggtttgagagggttaacagga
ccccctggaccaccaggagcagttattgtgacactgactggaccagacaacctaacggac
tctaaaggggataaaggagacaaaggatctgtgggtgagccaggacccccaggaccaaag
gggttacctggagaatcttatgcatctgaaaaaggcattcctggagaccctggtcctcag
ggacagcctgggaaagatggtgcccctggtttccccggccttcctggagctaagggtaaa
aagggtttgcctggattaactggcgaaactggcgttaagggatttaaaggagacattggc
ccaccaggattccgtggtccaacagaatactacagtggatacctggagaaaggcaatgat
ggcgctcctggccctccaggacccaaaggagaacgtggtccacgtggacccagaggtcca
ccaggagatattggtagacctggggcatcaagacctggtcttaggggtactccaggattt
ccaggaatcaaaggacataaaggagagagaggaccacctggcataaacataatggggcct
cccggacttcctggattcccaggcacaccaggctacaaggggttacctggtcttccagga
ccaccaggtaaagtaacttttcagaatggtcctccaggagaccatggagatccaggccac
gtggggtctccaggcatgcctggagcctatgggcccaaaggagaagaaggactgctgtgt
acccagtgcacttatactccaggacccccaggtctgccaggtttgcctgggttagatggt
gaaaaaggaactcaaggggggcaaggtcctgatggtttaaagggaagcccaggatctccg
ggatatacaggtctaccaggctttccaggtttcccaggtactcctggtgatcagggacaa
aagggagaaaaaggtgaaacatcacatgaaggagaagcaggagatcgaggggatccgggg
aacagaggagaccctggaaaaaagggctcagatggaattcctggaaaacctggcacaaaa
ggattaccaggaacaaaaggcgaaccggctgtgaatggtgaaaagggggataaaggtttt
ccaggaaatcctggtgaccctgggcacccaggacccatgggaccagctggagcatccaac
tatggaccaccaggaaaacctggaccaaagggagctacaggcgtgcctggatttcctgga
ttacctggaaatgacggtcctaaaggagaacctggtatagcagaaccagtacctggccct
ccaggacctcccgggttaccagggctacctggcctccaaggcacaactggaaaaccaggg
tccatgggaccgagtggtaacccaggtcctcctgggtctgatggtgaagcaggattccca
ggaattggagttcctgggcctcctggacaaagaggagacagaggttttccaggagccaaa
ggatcaccaggttgtccaggagaaatgggggaacctgggtcacctggaataccggggctc
ccaggagcaaagggagacccaggtacagcgattcctggaaaaccaggaatcactggtttt
caaggagaaaaaggaagttcaggggaaaatggagaacatgggctccctggacttccaggc
cttccaggatccccgggaaatgacggacctaatgggctaccaggagagcctggatttcct
ggaccgccaggatataatgggattccggggatctgcataccgggtgcaaagggaacccag
ggacttccaggtttaaatggactaaggggaccacaaggagacagaggcttggatggtcct
aaaggagacccagggataccaggcttagacaggtcaggatccccaggagaacctgggcca
ccaggactgccaggtcatcaaggagataaaggactagtaggtccaacaggacatccagga
gctccaggacatccaggtccaccaggccaaaagggagaagttggtatgatgggttttcct
ggaacaactgggcctcctgggatgcctgggaatccaggcgccccaggatacaagggtagc
tttggaattccaggaagaaaggggaagaaaggacttcctggagcaaaaggggaaagggga
aataaaggaaaccaaggaccatcaatgatatcggctgacataggagagaaaggtgaacca
ggaccaggaggacctttgggaggccttggacaaaaaggagagagaggtactccaggtcta
ccaggactacaaggccatgatggaatgcctggaagaccagggctaccaggactcagagga
gaccctggcaccataggtcaccctggagaaccaggaccacctggaggacctggaagcatg
gggcacatgggaatgccaggcccaaaagggaaaaaaggaactgcaggccacccaggtgta
actggccgaccaggcctccctggaattcagggcatgaagggagagaaaggagaaccaggc
tacgcaaaggatgcacagccaggacctccagggccaacgggagaaccaggacccccaggc
tccctaggcatgaaaggaggaagaggcccaccaggcccaccaggcccagtaggacctgct
ggaactgaaggaaaccagggacgttctggaaaccgtggccctccaggacagcctggccct
actggtgatttgggatttaaaggatgcaaaggtttccctggtactccaggaatgaaagga
cctccaggccctccaggagccccaggacctcctggaccaatgggtgaaaaaggaaaacaa
ggtggggatgcatttcctggcccatcaggagaaaaaggagaactaggtctgctaggggca
cttccaggtccaagaggtcttcctggtttacaaggagacaaaggaaatgaaggaaggcca
gggttacctggcatctatggtataaaaggtgtgatgggagatgtgggaccaataggcccc
attggcatgactggaccaccagggccaccaggttttcctggtgcactaattccaggccaa
aaaggaaatcaaggtcctccaggcttgggaggaaatccaggtgatcctggccccccaggc
ccaccttgtgaatacacatcaggaataaaaggagaaaaaggtttcccaggagaccctggg
cccacaggtccagcaggaaccataggagaccctgggcctcccgggcatctgggaatgcca
ggtaccccaggttttccaggttttggaggggatcctggatttcaaggatttcctggcatg
acaggagaaaagggcaacctaggacctccaggaccatttgggcctcctgggtcaattggg
ccaaaaggacctcctggtcaacctggagaccctggaacaattaaaattatatccctgcca
gggagcccagggcctcctggtcaacctggagacccaggaatgcagggagaaccaggacca
caaggaccagcaggatacccaggactgcaaggaccaagaggtcaaccagggaaaccagga
aaaccaggaattcctggcccagttggagaaaaaggcaacaaaggctctaaaggagaaatt
ggaccacctggatcagttggattgcctggattaaaaggaaaacctggaaactttggacca
cctgcaactgggtcatctatcagaggctttatcttcacccgtcacagtcaatcaacagag
attccttcatgccccagaggaacggtgcccctttatcagggctattctcttctctatgta
cagggaaatgaacaagcctacggacaagaccttggaactctcggtagctgcctacaacgt
tttaccacaatgccattcttgttctgtaataccaatgatgtgtgcaattttgcttcccga
aatgactactcgtactggctgtcaacaacagcacagatgccgatgaacatggccccaatt
actggcagagctgtggagccttatattagcagatgtacagtctgtgaaggtcctgccatg
gccatagcagttcacagtcagaccactgacatccctttatgtcctgatggctggatttct
ctttggaaaggattttcttttgtcatgtatacaagtgcgggctcagaaggctctgggcaa
gcactagcatcccctggctcctgcctcgaagacttccgcgccaatccatttatagaatgt
cacggcaggggaacctgcaactactattcgaattcttatagtttctggttggcttcatta
aatccaaggagaatgttcagaaaaccaactccatccactgtgaaagccggagagctagag
nagataatcagtcgctgtcaggtttgcatgaagagaagagactga

KEGG   Phascolarctos cinereus (koala): 110198932
Entry
110198932         CDS       T05867                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110198932 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110198932 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110198932 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110198932 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110198932 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110198932 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110198932 (LAMC3)
   05145 Toxoplasmosis
    110198932 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 110198932
NCBI-ProteinID: XP_020829227
UniProt: A0A6P5J4H4
LinkDB
Position
Unknown
AA seq 1580 aa
MEDFLSLCVGVLLCLGLQMAHGGMDACYDGQGHPQRCLPMFENAAFGHQVQVTNTCGTPP
EEYCLQMGAPGDTQLCHRCDASDPDRNHNASYLTDFHSQEESTWWQSQSMAFGVQYPNSV
NITLQLGKAYEITYVRLKFHTSRPESFAIYKRSWAGGPWVPYQYYSASCEKTYGKQEGQY
LRPGEDERVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYSFDESPILQEWVTSTELLISL
NRLNTFGDDIFKDPKVLQSYYYAITDFSVGGRCKCNGHASECVLDEGGQLVCSCQHNTTG
TDCEKCLPFYQDRPWARGTAEAANECLPCNCSGLSEECFYDWELYRSTGHGGHCQNCRDH
TAGPHCERCQENFYHWDQQQPCQPCDCHPAGSLSLQCDNSGTCECKPSVTGWKCDHCLTG
FHSLSEGGCRPCTCNAAGSLGSCDPGNGRCPCKDKVEGYLCDRCQPGTFNLQPHNPSGCT
SCFCYGHSMVCGASAHYGVHHIISDFHQGAEGWRARGPGGREEPAQWSQTGIFLKPKSEE
LWDFIAPERFLGDQRFSYGQPLSLTFRVPPGGSLLPVWLKLEGAGLALSLKPSNPTGTQQ
PGRPEEYLLAFSLQETSEDAKLLLPAFHFQRLLANLTALQIQVAGPRGRHPTGQMTLTEV
QLTSAGPGLSPLAPWVEECTCPKGYMGQFCESCSPGYKRETPLGGPYASCVPCTCNQHGT
CDPETGICQCLHNTEGTYCERCTPGFYGNSFLGRENDCKPCPCPGQSACTTIPESGEVVC
THCPKGQRGRLCEICDDGFFGDPLGRSGPLQPCQQCQCNGNVDPNAVGNCDPTTGHCLRC
LYNTTGAHCEQCQEGFYGSALAPRPLDKCTPCSCNPSGSAREQGACDPGTGQCSCLPHVT
GRDCHRCSPGFYDLQPERGCRSCKCHPVGSRENQCHPVTGQCPCLPGVGGVACTHCQPDF
FGFSAKGCRACNCSPLGSVTTQCHENSTCVCKPGFVGYKCDRCQENFFLTAEGSQCQECP
ICFSLVKKEATDLKAKLTVMERWLQKSDCDSPWRDYILQGESPRGDTYQSHSLLQGTREV
FLEQMEELESSMRATRHQLQAASKSVRCTRSSLEKTCIQMVDIEALLLSTELEIQQALGA
LTTMVIPQEVPNQLTNWSRLATESQALAKSCRNTASKIVAAAQRALLASNTSYTLLWSVV
EGTDAQKIQHELEDRYQEVQKAQEELRTSTAQAATEAKGTLASVQRISSEGAQRLAKLSP
PEILPLTHLARDLDRKLQDLEKTVAAKEHVFTEAAQGLLATSQEELQKIQPFEQLLDGAD
SALTLATSSITKARETVSDSRTLLTDLEEMRKTFPQSKDQVALRKKARIIQDRLIGDTQK
KTKQAERMLGNAASVSATAKKKAKEAELLAKERTKHSKALLRESKQEYRKAVKLTNQAQG
TLQDISRQVMVSKERRREMEKVEWVGTGLNKVERNIREARISLEMDIKILSVLLTRLGKL
DTHQALATALNETEQKLEPLRQHLDGEGPLQGKLSLLQQEAEQQEFQIQDLESDLKEIQA
DKQNLEDILRSLPEGCASWQ
NT seq 4743 nt   +upstreamnt  +downstreamnt
atggaagactttctcagtctctgtgtgggggtcctgctctgcctgggcctgcaaatggcc
cacgggggcatggatgcttgctacgatgggcaagggcacccacagcgttgtctgcctatg
ttcgagaatgcagcatttggccaccaggtccaggtgaccaacacgtgtggcaccccaccc
gaagaatattgcctccagatgggggcccctggagacactcagctgtgccaccgctgtgat
gccagcgatccagaccgcaaccacaatgcctcctacctgaccgacttccacagccaggaa
gagagtacctggtggcagagccagtccatggcctttggggtccagtaccccaactcagtc
aacatcaccctccagctgggtaaagcttatgaaatcacctatgtgaggctaaagttccac
accagccgtcctgagagtttcgccatctacaaacgcagctgggctgggggtccttgggtg
ccataccagtactacagtgcttcctgtgagaagacgtatggcaaacaggagggccagtac
ctgcggcccggagaggatgagagggtggccttttgcactgatgaatttagcgacatctct
ccactgagtggaggcaacgtagccttttccaccctggaaggccggcctagcgcctacagc
tttgatgagagccccatcttgcaggaatgggtaaccagcacagaactgctcatctccctg
aatcggctcaacacgtttggggatgacatctttaaggatcccaaggtgttacagtcctac
tattatgccatcactgacttctctgtggggggcaggtgtaagtgtaatgggcacgctagt
gaatgtgtccttgatgaaggaggccagctggtctgcagctgccagcacaacaccacagga
actgactgtgagaagtgcctccccttctaccaagaccggccctgggctcggggaacagca
gaggctgccaatgaatgtctgccctgcaattgcagtggcctctctgaagaatgtttctat
gactgggagttgtaccggagcactgggcatggtggtcactgccagaactgccgggaccac
actgccggaccccactgcgagcgatgccaagagaacttctaccattgggaccagcagcag
ccatgccagccctgtgactgccacccagcaggatctctcagcctgcagtgtgacaactca
ggcacctgtgagtgtaaacccagtgtgactggctggaagtgtgatcactgtctgacaggg
ttccattctcttagtgaaggtggatgcagaccctgtacctgcaatgctgctggcagctta
ggatcttgtgatcccggaaacggacggtgcccctgcaaggacaaggtggaaggctactta
tgtgatagatgccaacctgggacatttaacctgcagccccataatccttctggttgtacc
agctgcttctgttatggccactccatggtgtgtggagcttctgcccattatggcgtgcac
catatcatctctgacttccaccagggggctgagggctggcgagccagaggtccagggggc
agagaggagcctgcgcagtggagccagactggaatcttcctgaagccaaagagcgaggag
ctgtgggacttcattgcaccagagagattcctgggagaccagcgcttcagctatgggcag
cccctctctctgaccttccgggtaccgcctgggggctctctcctccctgtctggctgaaa
ttggaaggggcaggactagccctgtctctgaaaccctccaacccgacaggtacccaacag
cctggacggcctgaggaatacctgctggcgttcagcttgcaggagacctcagaggatgca
aaactcctgctccccgccttccacttccagaggctcttggccaacctgacggcactccag
atccaggtcgcaggtcccagaggcagacaccccacaggtcaaatgaccctgactgaggtc
cagctcacttcagcaggccctggtctgtcccctctagccccttgggtagaggagtgcaca
tgtcccaaggggtacatggggcagttctgtgaatcctgctctccagggtacaagagggag
acaccattgggcgggccttacgccagttgtgtcccctgtacctgtaatcaacatggcacc
tgtgaccctgaaacaggaatctgtcagtgcctgcacaacacagagggcacctactgtgag
cgatgcacccccggtttctacggcaactcctttttgggtcgggagaacgactgcaagcca
tgtccctgtcctggtcaatcagcatgtacaaccatcccagagagcggggaagtggtgtgt
acccactgccccaagggccagagaggacgtctgtgtgagatatgtgatgacggctttttt
ggggaccccttgggaagatccggccctctccagccttgccagcaatgccagtgcaatggg
aatgtggaccccaatgctgtgggcaactgtgaccccacaacaggccactgtctgcgctgt
ctctacaacacaacaggtgcccactgcgagcagtgccaggagggtttctatgggagcgcc
ctggccccgcgtcctctagacaaatgcactccctgcagctgtaacccgtcaggctcagca
cgagagcagggggcctgtgatccggggacaggccagtgttcttgcctccctcacgtgacc
ggacgagactgccatcgctgcagccctggcttctatgacctccagccagaaaggggctgc
cggagctgcaagtgccatcctgtaggttctcgggagaaccagtgccaccctgtgactggg
cagtgcccttgccttcctggggttggtggagtggcatgcactcactgccaacctgatttc
tttggcttctctgccaagggctgccgagcctgtaactgttccccactgggctctgtcacc
acccaatgccatgagaacagcacatgtgtgtgtaagccaggctttgtgggctacaagtgt
gatcgctgccaggagaactttttcctcactgctgagggctctcagtgccaggagtgccca
atttgcttctccctagtgaagaaagaggccaccgacctcaaggccaagctaacagtgatg
gagcgatggctgcagaagtctgactgtgacagcccctggagggactatatcttgcaggga
gagtcaccaagaggagacacctaccagagtcattctctgcttcaaggcaccagagaagtc
ttcctggagcaaatggaagagttggagagttccatgagggctacccggcaccagctgcaa
gcagcaagcaagagtgtcaggtgcaccaggagtagtctggagaagacctgcatccaaatg
gtggacatcgaggctctgctgctatcaacagagctggagattcagcaggcgttgggagcc
ctcacgacaatggtgatccctcaggaagtgcccaaccaactcaccaactggagtcgtcta
gccactgagtctcaggccctggccaagagttgtagaaatacagcctctaagatagtggca
gcagcacagagggccctgcttgcttccaataccagttacactcttctgtggagtgtcgtt
gagggcacagatgcccagaagatacagcatgaactagaggacaggtaccaggaggtgcag
aaggcccaggaggagctcagaacatctacagcccaggcagccacagaagccaagggcacc
ttagcatctgttcagcgcatcagctcagaaggggctcagcgcctggcaaagctctcccct
cctgaaatattgcctctcacacaccttgccagagacctggacagaaaactacaggatcta
gagaagacagtggctgctaaggagcatgtgttcaccgaagcagcccaaggcctcttggcc
acttcccaggaagagctccagaagatccagccctttgagcagctgcttgatggagctgat
tctgccctcaccctggccacctcatccattaccaaagccagagaaacagtcagtgattcc
aggactttgctgactgatctggaagaaatgagaaaaacgtttccacagtcaaaggaccag
gtagctctaaggaaaaaggcaaggatcatccaagacagactcattggtgacactcagaag
aagactaagcaggcagagaggatgctgggaaatgctgcttccgtctctgccacagctaag
aagaaggccaaggaagctgagctattggctaaagagaggacaaagcattccaaagccttg
ctgagggaaagtaaacaggaataccggaaagccgtcaaactcaccaaccaagctcaagga
accctccaggacatctccaggcaggtgatggtgtccaaggaacgaaggagggagatggag
aaagttgagtgggtagggactgggttgaacaaggtggaaagaaacataagggaagcccgg
atctccctggagatggacatcaagatcttgtctgtcctgcttactcgattggggaagctg
gacacccaccaagctctagccacagccctgaatgagacggagcagaagctggagccactg
aggcagcacctggatggagaggggcccctgcaggggaaactgagcctgctacagcaggag
gcagaacagcaggagttccagatccaagacttggagagtgacctcaaggagatccaggca
gacaaacagaacctggaagacattcttcgtagcctgcctgagggttgtgccagctggcag
tga

KEGG   Phascolarctos cinereus (koala): 110199966
Entry
110199966         CDS       T05867                                 

Gene name
LAMA1
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
pcw05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110199966 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110199966 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110199966 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110199966 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110199966 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110199966 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110199966 (LAMA1)
   05414 Dilated cardiomyopathy
    110199966 (LAMA1)
   05416 Viral myocarditis
    110199966 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110199966 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110199966 (LAMA1)
   05145 Toxoplasmosis
    110199966 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_N Laminin_B Laminin_I Laminin_II Laminin_G_3 DUF1080 Hepar_II_III
Other DBs
NCBI-GeneID: 110199966
NCBI-ProteinID: XP_020830665
UniProt: A0A6P5J965
LinkDB
Position
Unknown
AA seq 3085 aa
MPRCCGRGLIAAALLLWTAGQCQQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEH
VPGRPVKNAQCRICDRNSASPKERHPISNAIDGTNNWWQSPSIQNGREYHWVTITLDLRQ
VFQVAYIIIKAANAPRPGNWILERSLDGTEFTPWQYYAISDTECLTRYNVTPRLGPPTYK
RDDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLN
ADLMTLSHRDPKDLDPIVTRRYYYSIKDISIGGMCICYGHASSCPWDETTKKLQCQCEHN
TCGESCNECCPGFHQQPWRPGTISSGNTCEECNCHNKTKDCYYDQSVANQKKSMNIAGHF
KGGGVCVNCLQNTAGINCETCIDGYYRPHKVSPYENNPCLPCNCDPFGSLSSVCVKDDLQ
SDRLNGNWPGQCQCKEGYTGEKCDRCQFGYKGFPNCFRCNCSLAGSINDDPCSEPCLCKE
NVEGEECDRCKPGFYNLKERNPEGCTECFCFGVSDVCDSLSWPVTQVTDMSGWQVTDLSS
SSNIQSQQNQVDGPHQITINNSVAMQMLKSKYYWSAPTAYLGNKLTAFGGNLKYTVSYDI
PMETVDSDLMSHADVIIKGNGLTLSTRAEGLSLQPYEEYFHVVKLLPENFRDYNTKREID
RDQLMTVLANVTHLLIRTNYNTAEKALYRLDAVTLDIANPNVIDLVLATDAEYCECPQGY
TGISCESCLPGYYRVGGILFGGICQPCECHGHATECDIHGACLACKHNTTGAHCDQCLPG
FYGNPSSGTSENCQPCACPLTTASNNFSPTCHLDDGDEVICDQCQLGYTGTWCERCADGY
YGNPTVPGESCIPCDCSGNVDPLEVGHCDTVTGECLKCIGNTEGPHCERCADGFYGDALV
AKSCHACSCHGSSSLSRICHHETGLCDCKPNVIGQHCDQCLNGYYGLNTGLGCLPCNCSQ
LGSLSENCSDEGQCHCVPGVAGQRCDRCAHGFYGYQDGSCTPCNCAHTHNTCDPESGECI
CPPHTQGLKCENCEDEYWGHDPELGCKACNCSSIGSTSRRCDSLTGQCPCRQEHGGQSCN
ECAVGFRDYPDCVSCDCEVSGTKRDTCDEKRGVCSCEEETGTCFCKENVFGLHCSECKMG
TFALHADNPLGCSPCFCFRMTHFCSELEGYVRIPITLTPDQSILRVVSQSNLEGTIEGVY
YQHPEVLLDAATVRQHVNAEPFYWRLPNQFLGDQLMAYGGKLKYTVAFYSSDGIGTYNLE
PQILIKGGRTTKLVIYLNIPAPENGVRKEQEVDMKENIWKYFNSVSEKSVTRSDFMSVLS
NIDYILIKASYGQGLIQSRIANISMEIGVKAEEMHSNREVAYFLENCDCPPGFAGLSCQD
CAPGYHRAKLPEAGVRESRPLIAPCVPCHCNNHTETCHPETGKCLNCRDNTAGDHCDVCA
SGHYGKVRGFADDCSLCACPRTNASFSPTCVLEGDDDFRCNACSLGYEGQYCEKCSSGFY
GNPSKVDGSCQPCNCDPKGSVHSFCNAVSGQCICKPGVTGRACDECEPRHILVESKCVSC
DDECVGVLLNDLDNITDAISSVNLTGIIPVPHGILSNLENATKNLRESLANNKMAVSLER
ARKQLEGISEDTDNLQKELTQVLESSQHLNVITERMLKKSQDLAMFIEKLRTNIKVIVEE
AAALNETWSINQQLSNANLQNMQEDIASMLEVLHKRNLMQLHQNATTELKAAKNLLSRIQ
KNYQKPQRDLKELKEKANNHFLEYSNKLQEAQALVNEADAKTKETNRLLLIITTNLEELN
DKKLHVLENQNLSSTLIEKGKGLIAAVAALAKDAKNATEQLELHRDELLLWSAKIRHHVD
ELVMQMSKRGALDLVYRAEDHAAELMRLADVLDRGLTDVRDVSLNATNAVHAHSSTQSLI
EGAEKLAIEALRKAEITNLSVEPLVSNGKEALQRGAKLLREANNLDGKTKGVMSKMSELK
KKINGFQEHAHKLTKQLNDSLLMLGVMMPDGTQGTGLKIKLMARAANESATNTMNNIVDF
SQKLLNTSSALSRVNETLRKANQLLSDSSQATVLVERKVKEVKXQANLLFDRLKPLKMLE
ENLNRNLSEIKELISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLMLNVRTSEPD
NLLFYLGSSASSDFLAVEMRHGKVAFLWDVGSGSARLEFSDFPIDNNKWHRIYITRFGNT
GSLSIKEMSSTQKPLTKTAKSPGTANVLDVNESTLMFVGGLGGQIKKSPAVKVTHFKGCM
GEASLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFYFDGSGYSIVEKTLRSTVTQIIML
FSTFSPNGLLLYLASNGTRDFLSIELVDGKVKLTVDLGSGPLALTTDRRYNNGTWYKIAF
QRNKKQGLLAVFDAYNTTSKETKQGESPGGSSDLNRLNKDPIYVGGLPRSRVVRKGLTSR
SYVGCIKSLEISRSTFDLLRNSYGVRKGCLLEPIRSITIFNNGYIELPPKPLSTESELMA
TFATKNSSGVILAGLSKGKDKRSRRQAHVPFFSIVLIEGHLEVHVNPGDGMSTRKATLHS
TTGTYSDGKEHSIVLIRNKRIITVQVDEANHTEMRFGPLAEARIINVSNLYIGGIPEGEG
ISVFRMRKSFHGCIKNLIFNMELLDFTSAISYEQVDMDSCLLSEKPQPTVIHREDIELQP
EAHPLSSPEQCAVDREPDYAPNAHQFGLAVGSHLVLPFNQSAIRKKLSVQLAIRTFAPSG
LIYYMAHQNQIDYATLQLHEGQLYFMFDLGKGRTKASHPAFLSDGKWHTVKTEYIKRKGF
ITIDGQESTMVTTTGDGNTLDVEGKFYLGGLPLNYRAKNIGNITHGIPACIGEVMINGKQ
LDKSNPISASSVNKCYTMAQEGTFFEGSGFVALVKEGYKVRSDVNITLEFRTTAMNGVLL
GISSAKVDAIGIEMVNGKVSFHVNNGAGRITATYEPKSASSLCDGKWHKLQAHKSKHRIV
LIVDGKATPAESPHTQSTSADTNNPIYVGGYPADTKQNCLSSRTSFRGCMRKLTLIKGQQ
VESIDFSKAFDLRGVFPHSCPGTEL
NT seq 9258 nt   +upstreamnt  +downstreamnt
atgccccgctgctgcggccgaggactgattgcggcagcgctgctgctgtggaccgccggg
cagtgccagcagagaggtttatttcctgccatcctgaatcttgccagcaatgctcacatc
agcaccaatgccacctgtggtgagaagggtccagagatgttctgcaaactggtggagcat
gtaccaggacgaccagtcaaaaatgcccagtgcagaatctgtgaccgtaacagtgctagt
ccaaaagaacgtcatccaatctcaaatgccatagatggtactaataattggtggcagagt
ccaagcattcaaaatgggagagaataccactgggtgacaatcactctggacctaagacag
gtttttcaagtggcatatattatcatcaaagctgctaatgctcctagacctggaaattgg
attttggaacgctccctggatggcacagagttcacaccctggcagtactatgccattagt
gacacggaatgtctgactcggtataatgtcactccaagattagggcctcctacttataag
cgagatgatgaagttatctgcacctcctattattccagattggtcccgctggaacacgga
gagattcacacatcactgattaatggcagacctagcgctgatgatctctcacccaagttg
ttggaatttacttcagcacgatatattcgtctccgcttgcaaaggattagaacccttaat
gctgaccttatgactctcagccatcgtgatcctaaagatcttgaccccatagtcacaaga
agatattactattccataaaagacatttcaattggaggaatgtgtatatgctatggtcat
gctagtagctgcccatgggatgaaactacaaagaaactgcaatgtcagtgtgaacataac
acatgtggagagagctgcaatgaatgctgccctggttttcatcagcaaccttggcgacct
ggaaccatttcttctgggaacacatgtgaagagtgcaactgtcataataaaaccaaagac
tgttactatgatcagagtgttgccaatcagaagaaaagtatgaatattgctggacatttc
aaaggtggaggagtctgtgttaattgtctacaaaatacagcaggaatcaactgtgaaacg
tgcattgatggatactacagaccacataaagtttctccttatgagaacaatccatgtctt
ccgtgtaattgtgatccttttggttcactcagttcagtgtgtgttaaggacgatctacag
tctgaccggttgaatgggaactggccaggtcagtgccaatgtaaagagggttacacagga
gaaaaatgtgatcgttgccagtttggctacaagggtttcccaaattgctttcgctgcaat
tgcagtctggcgggtagtataaatgatgacccatgcagtgagccttgtctttgtaaggaa
aatgttgaaggggaagaatgtgatcgttgtaaaccaggattttataatctgaaggaaagg
aaccctgagggttgcacggaatgtttctgctttggtgtttctgacgtctgtgatagcctt
tcctggcctgtcactcaggtgactgatatgtctgggtggcaggtcactgacttgtccagt
tcaagtaatatccagtctcagcaaaaccaggtggatggacctcatcaaataactatcaac
aacagtgtggccatgcaaatgctaaaatccaagtattactggtcagctcctacagcatat
cttggaaataaattgactgcctttggtggaaacctaaaatatactgtgtcttatgatatt
ccaatggagactgtggacagtgacttgatgtctcatgcagatgttattattaagggaaat
ggactcactttaagcacgagggctgagggcttgtccttacaaccttatgaagagtatttt
catgtagtgaagcttttgcctgaaaacttcagagattataataccaaaagagaaatagat
cgggaccagctgatgactgtcttagctaatgtgactcatcttttgatcaggaccaattat
aatactgcagaaaaggcactttatagattagacgctgtgactttggacatagcaaaccca
aatgttatagatctggtgctggctactgatgcagaatattgtgaatgtcctcaagggtat
actgggatctcctgtgagtcttgtctcccagggtattaccgcgtaggtggaatactcttt
ggaggaatctgtcaaccctgtgagtgccatggccatgccactgaatgtgatattcatgga
gcttgcttggcttgcaaacacaacactacgggggctcactgtgaccagtgtttaccaggt
ttctatgggaatccttccagtgggacatcagaaaactgccagccctgcgcgtgtcctctt
acaactgcttccaacaatttcagccctacttgccatttggatgacggagatgaagttatc
tgtgatcagtgtcaactgggatatacaggaacatggtgtgagagatgtgcagacggttac
tatggaaatccaacggtccctggggaatcttgcatcccatgtgattgcagtggcaatgtg
gatcccctagaagttggtcactgtgatacagtcacaggagaatgtttgaagtgtattggg
aacacagagggccctcactgtgagagatgtgctgatgggttctatggggatgctcttgtt
gctaaaagttgtcatgcttgttcatgccatggaagcagttctctttccaggatctgccat
catgagactggtctctgtgattgcaaaccaaatgttattggacaacattgtgatcaatgc
ttgaatggctattatggtttgaatacaggacttggttgcctgccctgtaactgtagccag
ttaggttcactgtctgaaaattgtagtgatgaagggcagtgtcactgtgtgccaggagtt
gctgggcaaagatgtgaccggtgtgctcatggcttttatggatatcaagatggcagctgc
acaccttgtaactgtgctcatactcataatacctgtgacccagagtctggagaatgtatc
tgccctcctcatactcaaggtttaaagtgtgaaaactgcgaggatgagtactggggacat
gatcctgagctaggatgcaaggcttgcaactgcagtagcataggatcaactagtcgtcgg
tgtgattcgttaactggccaatgcccctgtagacaggaacatggaggccaaagctgcaat
gagtgtgccgtaggtttccgagactatccagattgtgtatcctgtgactgtgaagtgagt
ggtaccaaaagagacacgtgtgatgagaaacgaggtgtttgtagttgtgaagaagaaacg
ggcacctgtttttgcaaggaaaatgtgtttggtcttcactgcagtgaatgtaagatggga
actttcgctcttcatgctgacaatcctttgggctgctctccttgtttctgttttaggatg
acacacttctgttcagaattagaaggatatgttagaatccccataaccctcaccccagat
cagtccattctgcgtgtggtttcccaaagcaatcttgagggaacaatagagggggtatat
tatcagcaccctgaggttttattggatgctgccactgtcagacagcatgtgaatgcagaa
cctttttattggaggctacccaatcaatttttgggagaccagctcatggcctacggtgga
aaactgaagtacacagtggctttttattcatcagatggcattgggacttacaacttagag
ccacagattctgataaagggtggccgcaccactaagcttgtcatttacctgaatatccct
gctccagagaatggagtgagaaaggaacaagaagtagacatgaaggagaatatttggaaa
tattttaactctgtgtctgaaaagtctgtaacacgttcagattttatgtcagttcttagc
aacattgactatattctcatcaaggcctcatacggtcaaggattaatacagagcagaatt
gcaaacatctcaatggaaattggagtaaaggctgaagagatgcactctaatagagaggta
gcatactttttagagaattgtgactgccctcctggatttgctggactttcttgtcaggat
tgtgcacctgggtaccacagggcaaaacttccagaagctggtgtcagagaatcccgccct
ctgatagcaccgtgcgtgccatgccattgcaacaaccacactgaaacctgtcatccggag
actggaaagtgcctgaattgcagagataacacagccggtgatcattgtgatgtgtgcgct
tcaggacactatgggaaagtccgtggctttgctgatgactgctctctttgtgcctgtccc
agaaccaatgccagttttagtccaacttgtgtcttggaaggtgacgatgatttccggtgt
aatgcctgctctctgggatatgaaggacaatactgtgaaaagtgctcctctggcttttat
ggaaatccttcaaaggtggacggtagttgccagccatgtaactgcgatccaaaaggctct
gttcacagtttttgtaacgctgtatctgggcagtgtatctgtaagccaggtgtgactggc
cgtgcctgtgatgaatgcgaaccaaggcatatcctggtggaaagcaaatgtgtttcttgt
gatgatgaatgtgtgggtgtattgttaaatgacttggataatatcactgatgccatttcc
tctgtgaatctcactggcatcattcccgttccacatggaattttatccaacctggaaaac
gcaactaaaaatctcagggagtcattagcaaataataaaatggcagtttcgctggaaagg
gcaagaaaacaacttgaaggcatttcagaagacacagataatttgcagaaagagctcact
caggtattagagagtagccagcatttgaatgtcatcacggaaagaatgctgaagaaaagt
caagatttagctatgtttattgagaaactgaggactaatataaaagtcattgttgaagaa
gcagctgccctaaatgagacttggagtatcaatcagcagctgtccaatgctaatttgcaa
aatatgcaagaggacattgcatccatgctggaagtcttacataaaaggaatctcatgcaa
ttacaccaaaatgctactactgagctcaaagctgccaagaatttgttgtcacgaattcag
aagaattatcagaaaccacagcgagatctgaaggaactgaaagagaaagcaaataaccac
tttttggagtatagtaacaagctccaggaagcacaagctttggttaatgaagcagatgcc
aaaaccaaagagaccaaccgtctgttgcttattatcactactaatttagaagaactaaat
gataaaaaactgcatgttttggaaaaccaaaatttgtcatctacgttaattgagaaagga
aaaggactcatagcagctgttgctgcacttgcaaaggatgccaaaaatgctacagagcag
ttagaacttcatcgtgatgagctgctcttgtggagcgccaaaatcagacaccatgtggat
gaattagtcatgcagatgtctaagagaggagcccttgaccttgtctatagggcagaggat
catgcagctgagctgatgagactggcagatgtgctagacaggggtcttaccgatgtaaga
gatgtttctctcaatgcaacaaatgctgtccatgcccattccagcacccaaagcttgatt
gaaggtgcagagaaactggcaatagaagctctcaggaaagcagaaattacaaacctgtcc
gtggaaccccttgtttctaatgggaaagaagctctccagagaggtgccaaacttctgagg
gaggccaacaatctggatggaaaaactaaaggtgttatgtccaaaatgagtgaactgaaa
aaaaagataaacggatttcaggagcatgctcataaacttactaagcaacttaatgattca
ctgttgatgcttggagtgatgatgcctgatggtacccaggggacaggactaaagatcaaa
ttgatggcgagagctgctaatgaaagtgccacaaacactatgaacaacattgtggatttc
agtcagaagctgctgaacacttcatctgcattgtccagggttaatgaaacattgagaaaa
gccaatcagcttctaagtgactcatcccaggccactgtgttggttgaaaggaaagtaaaa
gaagtgaaancacaagccaatcttttatttgatcgtttgaagcctttgaaaatgcttgag
gagaacttgaacaggaacctgtctgaaattaaagagttgatcagtcaggcccgaaagcag
gcagcatctattaaagtggctgtgtctgcagatcgagactgtatccgtgcctaccaacct
cagatatcctctaccaactataacaccttaatgttaaatgttagaaccagcgaacctgat
aacctcctgttctacctgggtagcagtgccagttctgactttcttgctgttgagatgcgg
catggcaaagtggccttcctttgggatgtaggctcagggtctgcaagattggaattttca
gacttcccgatagataacaataaatggcaccgaatatacataaccagatttgggaacact
ggctcgttgagtataaaggaaatgagctctactcagaagccattaaccaaaactgccaaa
tcccccgggacagctaatgtgctggatgtaaacgagtcaacgttaatgtttgttggagga
cttggaggacaaataaagaagtcacctgctgtgaaagttactcattttaaaggatgcatg
ggagaggcgtctttgaatggaaaatctattggcctatggaactatattgaaagggaaggc
aaatgcaatggctgtttcggaagttcacagaatgaagattcctcgttttattttgatggc
agtggatattcaattgtggaaaagacactgcggtctactgtgactcagataataatgctt
ttcagtacgttttcaccaaacgggcttctcctctaccttgcttctaatggcacaagagat
ttcctctctattgagctggtggatggtaaagtgaaactcactgttgacctgggttcaggg
cctcttgctcttactacagacagacgttataataatggaacctggtacaagattgcattc
caacgtaacaaaaagcaaggactcttagcagtttttgatgcatataataccacttctaaa
gaaacaaagcaaggcgaatctcctggagggtcatctgacctaaatcgcttgaataaggat
ccaatttatgttggtggattgcccagatcgagagttgtaaggaaaggacttactagcaga
tcatatgtaggctgtattaaaagcctggaaatatccagatctacatttgacttactcaga
aattcctatggagtgagaaaagggtgtttactggagcctatccggagcattaccatcttc
aataatgggtacattgaattgccaccaaagccactgtcaacagagtctgagttgatggcg
acatttgccactaagaacagtagtggtgtcatcctggctggccttagcaagggaaaggat
aagagaagtcgtcgacaggcccatgtgcccttcttctccatcgtactgattgagggtcat
cttgaagtacatgtgaatcctggggatggaatgagcaccagaaaagccaccctccactca
accacaggaacatacagtgatgggaaagaacattccattgtcttgattaggaataaaaga
atcatcacagtccaagtagatgaggctaatcacacagaaatgagatttgggccactggca
gaagccaggatcataaatgtatctaacttgtacataggtggaatcccagaaggcgagggc
atttctgtcttcagaatgagaaaatcttttcatggctgtattaaaaacttgatcttcaat
atggagcttttggatttcacgagtgcaattagttatgagcaagtggacatggacagctgc
ctgctttcagaaaagcctcaaccaacagttatccacagagaggacattgagcttcagcca
gaggctcaccccttatcaagtcctgagcagtgtgcagtggatagagagccggactatgcc
cccaatgcccatcagtttggcctagctgtaggcagtcacttggttttgcctttcaaccaa
tctgctatcagaaagaagctttcagtgcagctggctatccgaacctttgccccaagtggt
ctgatttactacatggctcatcagaaccagattgattatgcaactcttcagcttcatgaa
ggacagctctatttcatgtttgatcttgggaaagggagaacaaaagcctcccatcctgcc
ttcctcagtgatggaaaatggcacacggtgaaaacagaatatatcaaaagaaagggcttc
atcacaatagatggacaagagtccacgatggtgaccaccacaggagatggtaacacctta
gatgtggaaggaaaattttaccttggaggccttccattaaattatagagccaagaacatt
ggaaatattacccatggcatccctgcctgcattggggaggtgatgattaatggtaaacag
ctcgacaaaagcaacccgatctctgcctcttctgtaaataaatgctatactatggcacag
gaaggtactttctttgaagggagtggatttgttgcacttgtcaaagaaggttacaaagtt
cgatcagatgtcaatatcacactagagtttcgtaccactgcgatgaatggtgttctcctt
ggaatcagtagtgccaaagtggatgctattggcatagagatggtaaatggcaaggtttca
ttccatgtcaacaatggggctggtaggattacagccacctatgaacccaaatctgcaagt
agtctttgtgatggaaaatggcataagcttcaagcccacaaaagcaaacaccggattgtt
ttaattgttgatggaaaagccactcctgctgaaagcccacacactcagtccacatctgca
gacaccaacaatcccatctatgttgggggatatcctgctgatacaaagcaaaactgcttg
agcagtcgcacctccttccggggctgtatgagaaagctcacgttgattaaaggtcagcaa
gtggaatccattgacttcagcaaagcttttgacctccgtggagtcttcccacattcctgc
cccgggactgagctctaa

KEGG   Phascolarctos cinereus (koala): 110200243
Entry
110200243         CDS       T05867                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain
  KO
K06237  collagen type IV alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04926  Relaxin signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04974  Protein digestion and absorption
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110200243 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110200243 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110200243 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110200243 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    110200243 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110200243 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110200243 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110200243 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110200243 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110200243 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110200243 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110200243 (COL4A4)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110200243 (COL4A4)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110200243 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 110200243
NCBI-ProteinID: XP_020831141
UniProt: A0A6P5JJ58
LinkDB
Position
Unknown
AA seq 1654 aa
GGKKYSSPCGGQDCSVCRCFPEKGSRGQPGHLGPQGPIGDLGPPGPIGLPGEKGMKGDSG
PPGPMGDKGDKGPTGVPGFPGLDGIPGYPGPPGSRGKPGIDGCNGSRGDPGFQGERGAPG
REGPAGLPGPGGEKGNSVYISGAIKGLPGDRGDPGPPGLPGPRGANGSVGKMGFPGVPGS
RGPPGHPGRPGDQGNPGVGVKGQVGDPGEVGLQGSPGPTLLVGPPASCLVKGEKGIKGMP
GVIGPSGPFGAKGEPGIGVKGEKGISGFPGPEGGPGSHGLPGFPGVKGEPGAIGVCGQFG
VLGTKGDPGERGKPGPPGVLITPPVPCKGPPGDRGFPGHWGEKGSVGLPGPSGPSGKPGE
DKIGMTGPPGPPGLPGEQGLQGEAGIPGRGDSPAGRPGTPGHPGTPGVPGQQGRPGSDVI
HCSIGPPGPQGVKGQSGSPGRRGTKGEKGDEGLCSCCPGPMGLPGAPGPHGLQGRKGEVG
LPGRIGEKGDSGFPGAQGSPGPPGIPGTSGLTGPKGEKGDMVIARIKGRKGEKGHDGLPG
YPGQEGVPGQNGLYGERGEPGLPGSHGGAIPGMEGSLGAPGSPGKMGPMGPPGLGFPGPE
GVRGGPGSPGRPGMRGAAGSKGQKGDTYPCPSPYPGSPGAPGVPGVPGHKGFPGPPGEAG
LPGFDGQKGQRGKPGISEIPGPPGFRGDPGESGPEGEKGSAPSGPPGPPGLPGINGQKGM
LGDSVYGLPGLPGNMGPPGPPGPSGLRGDPGFPGATGTTGVPGFPGMKGLQGRQGNVGPP
GNPGLPGHGCQGFPGLPGQPGLPGSPGIPGFDGLKGHQGDRGPPGPDGMKGLPGIPGIPG
LPGHPGPQGDSGHCGDNGSPGSPGPKGAQGLPGIPGFPGERGRKGEIGLPGRKGDPGEEG
HCGLPGEPGEPGSKGEKGHPGDQGDISIIPRKGEKGEPGPPGRYGFPGEKGKKDKAPGIP
GIKGILGRDGLPGFQRGEPGNHGHPGLPGPPGLPGPQGPRGIIGFPGIPGDQGELGLPGL
PGLPGPHGTRGPKGNQGDTVSLLGPPGPKGDPGIPGCPGYFGEQGDPGFPGPPGSTGPPG
REGSPGYPGPPGFPGAPGIPGLKGYPGEAGDPGPPGVQGDPGPPGPKGMKGSLGQPGLDG
LPGLKGQKGSKGSSGLNEVGPPGQMGLPGPKGKKGEPGRPGASCPGLAGDRGPPGPPGIP
GLPGLPGLVGKTPEVEILPPGPLGDQGSPGPEGPRGPPGPPGLPCSFDSLKGDPGDHGQP
GPPGPRGPPGPPGAKGFPGCEGQNGQKGPMGYPGPPGPPGFPGPPGDKGLQGPPGRPGPP
GPPGCPGEPGPPADTSSCPQIPGLPGVPGHRGPEGKMGHPGQRGPPGSPGHKGERGVDGQ
RGSDGGPGPPGPPGHKGDPGEEGCGGAPGPPGPIGDPGPKGSGTRYLNGFLLVLHSQTDK
EPSCPEGMPRLWTGYSLLYLEGQEKAHNQDLGLAGSCLPMFSTMPFAYCNINQVCHYARR
NDKSYWLSSAAPLPMMPLSEDEIQAYISRCAVCEAPALAIAVHSQDQAIPPCPPNWSSLW
IGYSFLMHTGAGDQGGGQSLTSPGSCLEDFRAAPFIECQGRQGTCHFFANEYSFWLTTVP
PDLLLSSAPLPDTLKQGQAQRQQTSRCQVCMKYS
NT seq 4965 nt   +upstreamnt  +downstreamnt
ggtggaaagaagtactctagtccttgtggaggacaagactgttcagtctgccggtgtttt
cctgaaaaaggatctcggggccaacctggacatctagggcctcaaggccctattggagat
ttaggacctcctgggcccattggattgccaggagagaaaggaatgaaaggtgacagtgga
cctcccggaccaatgggagataaaggagataagggcccaacaggagtacctggcttccca
ggcttggatggcatacctggctatcctggacctccagggtcaagaggcaaacctggcatt
gatggctgcaatggttcaagaggagatccagggtttcaaggagagagaggagcaccagga
cgagaaggtccagctggtcttccagggccaggaggagaaaaagggaattcagtgtatatt
tcaggtgctatcaaaggcctcccaggagatcgaggtgatccaggacctccaggtttacct
ggacctcgaggggcaaacggatcagtgggtaaaatgggatttccaggggtgccaggttct
cgaggacctccagggcaccctggaaggccaggtgatcagggtaatccaggtgttggagta
aaaggccaagttggagacccgggtgaagttggtcttcaggggtctccaggaccaacctta
ctggttgggcctcctgcttcgtgtcttgttaagggagaaaagggcataaaaggaatgcct
ggagtcattggtccttctggaccgtttggagccaagggtgaacctggtattggggtgaag
ggtgaaaagggtatttctggatttccaggacctgagggtggccctggttcccatggactt
ccaggttttccaggagtaaagggagaacctggagcgattggtgtctgtgggcagtttgga
gttcttggcactaagggagatcctggagagcgtgggaagccaggaccaccaggtgttttg
ataactccacctgttccatgcaaaggacctccaggggaccgaggattcccaggacactgg
ggagaaaaggggtcagtgggactgcctggtccatcgggaccctctggaaaaccaggggaa
gacaaaataggaatgacaggaccccctgggcctccagggttgccaggtgagcaaggcctt
caaggtgaagctggaattcctggaagaggcgattctcctgcaggaagaccagggactcca
ggacacccagggacaccaggagtcccagggcagcagggtcgacctggatcagacgtcata
cattgcagcattggccctcctggaccacaaggagtgaaaggtcaatcaggatccccagga
agaagaggcacaaaaggagaaaaaggagatgaagggctatgttcatgctgcccaggtcct
atgggccttccaggtgctccggggccacatggtctccagggtaggaaaggagaagtgggt
ctacctgggagaataggagaaaaaggtgactcgggctttcctggtgctcaaggatcccca
ggacctccaggaatacctggtacctcggggctaactggtcctaaaggagaaaagggtgat
atggttatagcaagaatcaaaggaagaaaaggagaaaaggggcatgatgggcttcctgga
tatccagggcaggaaggggttcctggtcagaatggactgtatggagaaagaggagagcca
ggtcttccaggcagtcatggcggagcaatcccaggcatggaaggatccctgggagcacca
ggatctcctgggaagatgggaccaatggggcctccaggactgggatttccaggtccagaa
ggggtgagaggagggccagggagtcctggccgccctggtatgaggggagcagctggttcc
aaaggccagaaaggtgacacctatccttgtccttctccctatcccgggagccctggagct
ccaggtgttcccggtgttccgggtcataagggatttccagggcccccaggtgaagctggg
ctacctggatttgatgggcagaaaggccaacgaggcaaaccaggaatatcagaaatacca
ggaccacctggttttcgaggtgatcctggagagtccggtcctgaaggtgaaaaagggtca
gcccctagtggtcctccaggccctccagggttaccaggaatcaatggtcaaaaaggaatg
ctgggggattctgtttatggcctgccagggcttccaggaaatatgggccctccaggaccg
cctgggcctagcgggctcagaggtgatccaggatttcctggagcaacagggacaactggt
gttccaggattcccaggcatgaaaggacttcaaggcagacaagggaatgttgggcctcct
ggtaacccaggtttaccaggccatggatgtcaaggctttccagggttgccagggcaacct
ggactccctgggtcaccaggcattccagggtttgatggcttgaaaggtcaccaaggagac
agaggtccacctggaccagatggaatgaaaggcctcccaggaatcccaggaattccaggc
ttacctggacacccaggaccacaaggggattcaggccactgtggagataatggctcaccg
ggttccccaggcccaaaaggggcccaaggcctgccaggtatcccaggctttccaggagag
cgaggaaggaaaggagaaataggacttccaggtagaaagggtgacccaggagaagagggt
cattgtggccttccaggagagccaggagagccgggctctaaaggagaaaaaggccatcca
ggagatcaaggggatatttccataattccaagaaaaggggaaaaaggtgaacctgggcca
cctggtagatatggattcccaggagaaaaaggtaagaaagataaggctcctggaatccca
gggataaaaggaattctgggaagagatggactacctggttttcaaagaggagaacctggc
aaccatggtcatccgggacttccaggacccccaggcctcccaggacctcaagggcccaga
ggaataattggttttccaggcattccaggggaccagggtgagttgggcttaccaggcttg
cctggccttccaggacctcatgggacaagaggacctaaaggaaatcaaggtgatacagta
agtcttttggggccacctggaccaaaaggagatccaggcatccctggatgtccaggatat
tttggagagcaaggggacccaggttttccaggccctccagggtctactggaccaccagga
agggaaggatcccctggatacccaggacctccaggatttccaggtgctccagggattcct
gggttgaaagggtatccaggagaagcaggtgacccagggcctccaggggtccagggagat
ccaggaccaccagggcccaagggaatgaaaggctccttgggacaaccaggattagatggc
ttgcctggactcaagggtcagaaaggatcaaagggtagttcaggcttaaatgaagttggc
ccaccaggccaaatgggactgcctggaccaaaagggaagaaaggggaacctggaagacca
ggagcttcttgtccaggtcttgctggagacagaggtcccccaggtcccccagggatacca
ggactgcctgggctacctggtcttgtggggaaaactcctgaagttgaaattcttccccct
ggacctctgggagatcaaggttcccctggccccgagggaccaagaggtccacctggacca
ccaggtcttccatgcagttttgatagcctgaaaggagatccaggtgatcatggtcaacca
ggtccacctggaccacgaggtccaccaggacctccaggagctaaaggctttccaggatgt
gaaggacaaaatggacagaaagggccgatggggtaccctgggcctccaggcccacctgga
tttcctggcccacctggagataaaggtttgcaaggaccccctgggagacctggtccccct
ggtcctccaggttgcccaggtgaacctggcccacctgcagatacttcttcatgcccccaa
atcccaggacttccaggagttccaggacacagaggaccagaagggaagatggggcaccca
gggcaacgaggtcctccaggctcaccaggacacaaaggggaacgtggtgtggatggccaa
agaggttcagatggtggtcctgggcctccaggaccccctggacacaaaggagacccggga
gaagaaggctgtggaggtgcaccaggtccccctggcccgattggggatccaggacccaaa
ggttctggaactagataccttaatggattcctactggttctccacagtcagacagacaaa
gaaccctcttgccctgagggaatgcccaggctgtggactggatatagtttgttgtatctg
gaaggccaggagaaagcacataaccaagacctaggtctcgctggttcctgccttccaatg
tttagcaccatgccatttgcctattgcaacattaaccaagtctgccattatgccagaagg
aatgacaaatcctactggctgtcgagtgctgctcctctacccatgatgcccctctctgaa
gatgagatacaagcttacatcagccggtgtgctgtgtgtgaggccccagctctggctata
gctgtgcacagtcaagatcaggcaattcctccatgtccacccaactggagtagcctttgg
atagggtattcattcctaatgcacacaggggctggggatcaaggaggaggccagtccctc
acatcacctggaagctgccttgaagatttcagagcggcaccattcatcgagtgccaagga
cggcaggggacttgtcactttttcgctaatgaatacagcttctggctaaccacggtacca
ccagacttgctgctctcttcggctcctttgccagacaccttaaaacaaggacaggcacag
cgccaacagaccagcagatgccaggtctgcatgaagtatagctaa

KEGG   Phascolarctos cinereus (koala): 110205178
Entry
110205178         CDS       T05867                                 

Gene name
LAMA5
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110205178 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110205178 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110205178 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110205178 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110205178 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110205178 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110205178 (LAMA5)
   05145 Toxoplasmosis
    110205178 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_B Laminin_G_3 BLOC1_2
Other DBs
NCBI-GeneID: 110205178
NCBI-ProteinID: XP_020837188
UniProt: A0A6P5JUR4
LinkDB
Position
Unknown
AA seq 3706 aa
MARWGAGHRRGDASLGALSLLLLLLLLLLCGGAVAPEAGGEGGGSWSGGNSGGFSLHPPY
FNLAEGTRISASATCGEEAPVGARGPPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICT
SANINKAHPITNAVDGTERWWQSPPLSRGLEYSEVNVTLDLGQLFHVAYVLIKFANSPRP
DLWVLERSTDFGLTYQPWQYFASSKRDCIEKFGLQTLERITRDDDVICTTEYSRIVPLEN
GEIVVSLVNGRPGAMNFSYSPLLRNFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRY
YYSIKDISIGGRCVCNGHADVCDAKDPTNPYRLQCACQHNTCGGACDRCCPGFHQLPWKP
ATMDSANECQSCNCHGHAHDCYYDPEVDRHKASKNWDNVYEGGGVCIDCQHHTTGINCER
CIPGYYRSPEHPIDSPYVCYRCNCESDFTDGTCEDLTGRCYCKPNYTGERCDACAKGFTD
FPHCYPVPSFSHNTGAQVLPAGQIVNCDCSAAGTLGNACRKDPHIGQCVCKPNFQGVHCE
QCAPGYYGPGCLPCQCSGPGQTGSSCDNETGQCVCRTGFEGPACDRCAPGYFSYPLCQLC
GCSPVGTLPEGCDESGRCFCRPEFDGLHCDRCQAGYHSYPQCQVCSCDPRGSLNQLCSGS
GMCHCRPGYAGSSCQECAPGYYGFPNCIPCRCSEVGSLHTTCDPETGQCSCRPQVAGLHC
DTCVPGTYGFPRCEVGSCDPAGQASASSSLSEGSCECRAHVEGPRCDRCKPLYWNLSPAN
PYGCRSCSCDPRGTINGVAECQQGSGQCFCKPNVCGQMCTSCKDGYFRLDHADYFGCQTC
QCDIGGALAQGCEPRTGTCQCRPNTQGPTCSEPARDHYLPDLHHIRFELEEGSTPDGRPV
RFGYNPLEFENFSWRGYAQMTPVQPKVVVKLNVTSPDLFHLVFRYVNRGSTSVNGKVSVL
EEGKFSTCSNCTEQTRQVIFAPSTEPVFLTVPQNSYGEPFVLNPSIWSLVIEAEGVLLDY
VVLLPSAYYEAPILQVKVTEACTYNPKPEQVRNNCLLYTYLPLDGFPFASGTDAICRLDN
SLPKACLMEQPSSSHPPLATCWGNDVDVQVQIVVPQPGQYALVVEYANEDDLQSVSVAVH
TPQWTPQQGQLTLYPCQYSFLCRGTVLDSQNRLATFELTGEASIRLTAEHARFLLYRIYL
VPMSKFTTEFVEPRVHCISSHGTFGLSSGSCIPSRFQKLSQPIVLTECKVLPVPPDFPLS
HTHTVTPAGPPMSPQPRPPTAIDPTSDPTLLQAPQSTVVFSTHIQTLGRYAFLLHGYQPN
HPTFPVEVVINGGRIWHGQANATFCPHAYGCRSLVVCEGQIVLDVTDNELTVTVRVPEGQ
QLWLDYVLVIPEDGYSSNYLREEPLDKSYDFISLCAANGFYISPTSSPAFCQDAAISLSL
FYNNGAQPCRCHEVGAMSPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPSCRPCDCGTR
LCDEGTGQCICPPRTIPPDCVVCQAQTFGCHPLVGCEDCNCSRPGVKDLTDPGCDLDSGQ
CKCKPNVVGRRCDACAPGFYGYPSCRQCQCHTAGTVPGVCDPVTGQCHCKDNVEGVRCDQ
CRLGTFSLDASNPKGCTRCFCFGATDRCRSSQQVRGEFIDMQGWVLLSGERQEVPTSLRV
DAGLMHADLRNVPEAFQDLYWQAPASYLGDRVSSYGGSLRYELHSETQRGDVFVPTESRP
DVILKGNQMSITFLESSYPAPGDIHRGKVDLVEGNFRHTATHNPVSREELMMVLAGLEQL
QIRALFSQISSAVSLQRVVLEVVTDATGGAQASNVEVCMCPANYRGDSCQECAPGYYRDT
KGHFLGKCIPCHCNGHSDRCLPGSGICVGCQHNTEGDHCERCKGGFVSNATQDQSSSLCI
SCPCPLSVPSNNFAVGCVHKGGATQCLCQPGYAGASCERCAPGYYGNPLVIGSSCQPCDC
SGNGDPNLLFSHCDPLTGACLGCMYHTAGPHCENCAPGYYGNALLPRNCTKCDCSPCGTE
MCDARTGRCLCKSGVTGQHCDRCQDGHYGFDSCGGCRPCNCGLAAIGSGCHSQSGQCRCQ
TGVSGAQCQQCAPGYWGFSEHGCTRCQCRGGHCDPRTGECTCPPGLSGKQCDSCSHQHQV
PVTHGPGGVHCEVCDSCVVLLLDDLERIESLFPTIRQQLSSLNASSVAWARLHGINSSIA
ALANQLRGPLGSREPTRQRLDELERQSGVLEEEANTLQSKVADAQAQADQLQESSGDNLQ
RAETLLRSIQNVERALGELISQMDRLSPSNTSAASGEEFLRTLGEVERMLQEMRGRDFGR
PRAVAEGELEEAQRLLNRVQSQLTSRWEESQTLASSIRERLAQHSSQLMDLRDALNEAVN
KTRLTEELNSRNQEHLEERLQKIQELERENSTLRDTLRMAKDALAQVSELLQTMDRAKEE
YERLAANLDGARTPLTEKMQKFSPASSKIPIVERAEEHARELDQLAYNLSSIIRDTNQDR
FIQRAIEASNAYASILQAVGKAEEAAGQALHSATSTWEMVIHGGLSARARELRENSSILE
EAVRSQQRKLSGVIRETLQASQTQLEEAKAKKDRLVAQLKGVQNMLAMDRDDTSEKIARA
KAVATEANDTATQVGATLRDMERNLHRWQGQYGDLKNQDLVQAMEDAGKSVSSLEKTLPQ
LLAKLSQLENKRGQNASLALSTSILRVRELITQARSAASKVKVSMKFNGRSGVQLRPPRD
LQDLAAYTALKFYIQSSEPPQQQGQDGSSQFVLYMGSREASGDYMGVILHEHKVQWVYRL
GEAAHRTLTIDEDIREQFATVSIDRILQYGHMSVTVEKQTVHETKGDSVYPGDQGLLNLR
PQDFVFYVGGYPSNFTPPRPLQYPGYRGCIEMDTLNEEVVSLYNFQRTFHLDTALDKPCA
RSKSTGDPWLTDGSYLDGTGFAHISFESQISSTKRFEQELRLVSYTGIIFFLQYQDQFVC
LAVQEGHLILYYDFNHGLQIATPQQELTPLTSSNKAIQIFIMGVTGRKRVLVRVERVSVF
SLQEENMLENADSYYLGGVPPDQLPPSLRSLFPTGGSIRGCVKGLKALGKYVDLKRLNTT
GISSGCTSDLLITRSMTFHGHGYLTLALRDVPPITGNFYTGFGFRSTQDNGLLYYHASPE
GIFQVSLRQGRVILKFLRTEVMTRVAYADGVSHYVAIYSNDTGVWLYVDDRLEGAEHQGG
RSRRQAAAEGPPRFLLGGLPESGAFQNLTGCISNVFVRRVSEAQRVVDLQQNIQNVNVTT
GCTPPDGPLQLRASPRKFRRKPKAALHDQGMPPDSACQFPTHPKTISNAYQFGASPASRL
EFAHIPSSFQDRTHFSMDVQLRSPRGLLLAVPTVKSGSPFLVLYLSHGRFVLQAGGHGKP
LRVRSQERYKPGGWHTVFFSQEQNRVQLVIDGLRAQSSEGPRAYRRALLGHGPIYVGGVP
SGQSWTHLPEAAGTSFKGCMRNLKLNGQPLETPTQLHGVIPCYTGTLEKGLFFAAEGGTV
TLDLPEVWGPDLELVLEVRPRAALGLIFHLGPRQGPPYIRLEADGDKVIVRANNGAGEFS
TSVTRPPLCDGQWHRIAVIKRRKVVQLEVDTEGNYTVDPALVPSIITKEPLYLGGLPETL
KHMVPPSSQPGYYGCMRNLVANRRLINLTHNGIIQGSVGARGCPVM
NT seq 11121 nt   +upstreamnt  +downstreamnt
atggcgaggtggggagctgggcaccgccggggggacgcgtctctcggcgcgctgtccctt
ctgttgctgctgctgctgctgcttctctgtgggggggctgtggcgcccgaggccggtggc
gaaggtggaggcagctggagtggtgggaacagtggcggcttcagcctacacccaccctac
ttcaacctggccgagggcacccgtatctcggcttctgcgacttgcggcgaggaggcgccg
gtcggagcgcgaggccccccgcggcccaccgaggacctttactgcaagctagtggggggg
ccagtggctggcggcgaccccaaccagaccatccagggccaatactgtgatatctgcaca
tcagccaacatcaacaaggctcatcccatcacaaatgcagtggatggaacagaacgatgg
tggcagagccctccactctcccggggtttggagtacagcgaagtcaatgtcaccctagac
ctgggccagctttttcacgtggcctatgtcctcatcaagtttgccaactccccgagacca
gacctctgggtacttgagagatccacagactttggactcacctaccaaccctggcagtac
tttgcctcatctaagagggactgcattgagaagtttgggcttcagacgctggagcggatc
accagggacgatgatgtcatctgtaccactgagtactctcgcatcgtacccctggaaaat
ggggagattgtggtgtctctggtgaatgggcggccaggggccatgaatttttcatactcc
ccactccttcggaattttaccaaggccaccaacatccgccttcgttttctacgcaccaat
actctacttggccatttaatggggaaggcgctacgagaccccactgtcactcgacggtat
tactacagcatcaaggatatcagcattgggggtcgctgtgtctgcaatggtcatgcagat
gtctgtgatgccaaagatcccacaaacccctacaggctccaatgtgcctgtcagcacaat
acctgtggtggtgcctgtgaccgctgctgtcctggcttccaccaactgccttggaaacct
gccacaatggacagtgctaacgagtgtcagtcctgtaactgtcatggacatgcacatgac
tgttactatgacccagaggtggatcgacacaaagctagtaagaactgggacaacgtctat
gaaggtggaggtgtctgtattgactgccagcaccacacaactggcatcaactgtgagcgc
tgtatccctggttattatcggtcacctgagcatcccattgactccccctatgtctgctac
cgttgcaactgtgagtcagacttcactgatgggacatgtgaggacctgacaggccgttgc
tactgcaaacccaactacacaggggagaggtgtgatgcatgtgccaaagggttcacagat
ttcccccattgctatcctgtgccctcgttctcccacaatactggggcacaggtgcttcca
gctggacagattgtgaactgtgactgcagcgctgctgggaccttgggaaatgcctgtcgg
aaagacccacacattggccagtgtgtgtgtaaacccaacttccagggtgtgcactgtgag
cagtgtgccccaggctactatgggccaggctgcctgccctgccagtgttctggccctggc
cagactggtagcagttgtgacaatgagacggggcagtgtgtgtgccgtactggcttcgag
ggccctgcctgtgaccgctgtgcccctggctacttcagctatccactctgccaattatgt
ggctgtagcccagtagggactctgcctgagggctgtgatgagtctgggagatgcttctgc
cgccccgagtttgatggactgcactgtgaccgctgccaagctggctaccactcctacccc
cagtgccaagtttgttcctgtgaccctcggggctccttgaaccagttatgcagtgggtct
ggaatgtgtcactgtcggcctggttatgctggatcttcgtgccaggaatgtgcccctggc
tattatggattccccaactgtatcccttgtcgctgctctgaggttgggtccctccacact
acctgtgaccctgagactgggcagtgcagctgccggccacaagtggctggtctgcactgt
gacacctgtgtgcctgggacctacgggtttccccgctgtgaagttggctcctgcgatcca
gctggccaggcctcagccagctcctctctctctgagggttcctgtgagtgccgggctcat
gtggagggtccaagatgtgataggtgcaagcctctctattggaacctgagcccagctaac
ccctatggctgcagaagctgtagctgtgaccctcgaggtaccatcaatggagtggctgaa
tgtcaacagggcagtggacagtgtttctgcaaacccaacgtctgtggtcagatgtgcacc
tcctgcaaggatggctacttcagactggaccatgcagattacttcggctgtcagacctgt
cagtgtgatattgggggagccttggcccagggctgtgagccaaggacagggacctgtcaa
tgccggcccaacacacaggggcccacatgcagtgagcctgcaagagaccattatctccca
gacctgcaccacatcaggtttgagctagaggagggctccacgcccgatggccggcctgtg
cgttttggctacaaccccttggagtttgagaatttcagctggaggggttatgcccagatg
actcctgttcagcccaaagtagtggtgaaactcaacgtgacatcacctgacctcttccat
cttgtattccgctatgtcaaccggggttccacaagtgtgaatgggaaggtttcagtcctt
gaggaagggaagtttagcacctgcagcaactgcacagagcagacccggcaggtcatattt
gcacccagcacggagcctgtgtttcttaccgtaccccagaacagctatggggagcccttt
gtcctgaaccccagtatctggtccctggttattgaggctgaaggtgtcctcctggactat
gtggtcttgcttcccagtgcatactatgaagcccctatcctgcaggtgaaggtgactgag
gcctgtacctacaaccccaaacctgagcaagtcaggaataactgcctcttgtacacctac
ctcccactagatggcttcccctttgccagcgggacggatgccatatgccgcctggacaat
agtctacccaaggcttgcctgatggaacagcctagttcctctcacccacccctggccact
tgctggggcaatgatgtggatgtccaagtgcaaattgtcgtgccccagcctggccagtat
gcacttgtcgtggagtatgccaatgaggatgaccttcagagtgtgagtgtggctgtacac
actccccagtggaccccacagcaaggacagctcaccctctacccctgccagtacagcttc
ctgtgccgaggtactgtcttagattctcagaatcgccttgctacttttgaactcactggt
gaggctagcattcggctcacagcagaacatgcacggttcttactgtaccgcatctacctg
gtccctatgagcaagttcaccacagagtttgtggagcccagagttcactgcatcagtagc
catggcacctttggactgagcagtggttcctgcatcccttcgcgcttccagaagctatcc
cagcccatcgtactaacagagtgtaaagtcctaccggtgccacccgacttcccattgagc
cacacgcacaccgtcactcctgctggacccccaatgagtcctcagcctcgtccacccaca
gctatagatcccaccagtgatcccacccttctgcaggctccccagagcactgtcgtgttt
agcactcacatccagacactggggcgttatgccttcctgctccatggctaccaacccaac
caccctactttccctgtggaggtagtcatcaatggaggccggatctggcatggccaagcc
aatgccaccttctgcccccatgcttacggttgccgcagcctggttgtgtgcgagggtcag
atcgtcctggatgtgacagacaatgagctgactgtgactgtccgtgtgcctgagggtcag
cagctctggctggactatgtactggtcatccctgaggatggctatagctccaactaccta
cgagaggagcctctggacaaatcctatgacttcatcagtctctgtgcagccaatggcttt
tacatcagccccaccagctcacctgcattctgccaggatgctgccatctctctttccctc
ttctacaacaatggggcccagccctgccgctgccatgaagtgggagccatgagccctacc
tgtgaaccctttgggggccagtgcccctgccgagcccacgtcattggccgggactgctcc
cgctgtgccactggttactggggtttcccaagttgcaggccttgtgactgtggcacccgc
ctctgtgatgaaggcactggccagtgcatctgcccaccccgcaccatcccaccagactgt
gtggtctgccaggctcaaacatttggctgccaccccctggtgggctgcgaagattgtaac
tgttctcgccctggcgtcaaggatctcacagaccctggctgtgacttggacagcgggcag
tgcaagtgcaaacccaatgttgttggccgccgctgtgatgcttgtgctcctggcttctat
ggttatcccagctgccggcaatgccagtgccatacggcaggcacagtacctggagtgtgt
gaccccgtgactggccagtgccattgtaaggacaatgtagagggtgtacgctgtgaccag
tgccgccttggcaccttctccctggatgcctcaaaccccaagggctgtactcgctgcttt
tgctttggggccactgaccggtgccggagctcccagcaagtccgtggagagtttatagac
atgcaaggatgggtgctgctgagtggggagcgccaggaggtgccaacatcacttcgtgtg
gatgctgggctgatgcatgctgatctacggaatgtcccagaagcatttcaagacctttac
tggcaggcacctgcctcctacctaggggaccgggtgtcatcttatggtgggagcttgcgc
tatgagctgcactcagagacccagcgtggggatgtgtttgtccctaccgagagccggcca
gatgtgatcctgaagggaaaccagatgagtatcactttcctggagagttcctacccggct
cctggggacattcatcgagggaaggtggatctggtggagggcaatttccgccacacagca
actcacaaccctgtctcccgggaggagctaatgatggtgctggctggtttggagcagctg
cagatccgtgccctcttctcccagatctcctcagctgtctcccttcagagggtggttcta
gaggtggtgacagatgccactgggggagcccaggccagcaatgttgaggtctgcatgtgt
cctgccaactaccgtggggactcatgccaggaatgtgctcctggctattaccgagacacc
aagggccacttcctgggcaaatgcattccatgccactgtaatgggcactcagaccgatgc
ctcccaggctcaggcatctgcgtgggctgccagcacaatactgaaggtgaccactgcgaa
cgatgcaagggtggctttgtgagcaatgcaacccaagaccagtcatcttccctctgcatc
agctgcccctgccctctctctgtgccctccaacaactttgcagttggatgtgtccataag
ggtggggccacccagtgtctctgccagcctgggtacgctggagcttcttgtgagcggtgt
gctcctggatactatgggaaccccctggtgattggcagctcctgccagccttgtgactgc
agtgggaatggtgaccctaacttgctgttcagtcactgtgatccactgactggggcatgc
ttgggctgcatgtaccatacagcaggtccccactgcgagaactgtgctcctggttactat
ggcaacgctttgctccccaggaactgtacaaagtgtgactgctcaccctgtgggaccgag
atgtgtgatgctcggaccgggcggtgtctctgcaaatctggggtgactggtcagcattgt
gatcgttgtcaggatgggcactatggctttgacagttgtggaggctgccggccctgtaac
tgtggtctggctgcaattgggtccggctgccactcccagagtgggcagtgccgttgccag
acaggggtcagtggagcacagtgccagcagtgtgcccctggctactgggggttcagtgaa
catggctgtacccgctgtcagtgtcgaggaggtcactgtgatccccgcacaggcgagtgc
acctgcccccctggcctaagcggcaaacagtgtgattcctgcagccaccagcatcaagta
cctgtgacccatggccctggtggcgtccactgtgaagtgtgtgacagttgtgtggtacta
ctactggatgacctggagcggatagagtcactcttccccaccatccgccagcagctcagc
agcctcaatgccagctcggtggcctgggcccgattgcatgggatcaatagctccattgct
gccctggcgaatcagcttcgaggcccactggggtctcgggagccaacaagacagagacta
gatgagctggaacgtcagagtggagttctggaggaagaggccaacacacttcaaagcaag
gtggccgatgctcaagcccaggcagatcaactacaggagagctccggggacaacctgcag
cgggcagagaccctgctacggagcatccagaatgtggaacgtgctctaggggagctgata
tctcagatggacagactctccccgtctaataccagtgcagcctctggtgaagagtttctt
cggacactgggggaggtagagcggatgctacaggagatgcggggcagagacttcgggaga
ccacgagcagtggctgaaggggagctggaagaggcacagagattactgaaccgagtgcag
agtcaactaaccagccggtgggaagaaagccagaccttggcatcaagtatccgggagcgg
ttggctcagcacagctcccaactcatggacctccgggatgccttgaatgaggctgtcaat
aagactcgtctcactgaagagctcaacagtcggaaccaagaacacctagaagagaggctg
caaaagatacaggagttggagagggagaactcaacgctgagggataccctgcgcatggcc
aaggatgccttagctcaagtctctgaacttttgcagaccatggacagggccaaggaggag
tatgagcgtctggctgctaacttggatggtgcccggaccccactgacagagaagatgcag
aaattctctcctgcaagcagtaagattcctatagtagagcgggctgaggagcacgcccga
gagcttgaccagcttgcatacaacctctccagtatcattcgtgacaccaaccaggatcgg
ttcattcagcgagccattgaagcctctaatgcatatgccagcatccttcaggccgtgggg
aaggctgaggaggctgctggccaggccctacacagtgcaaccagcacctgggagatggtg
attcatggagggcttagtgcccgagcccgggagctccgggagaacagcagcatcctggaa
gaagctgtccgcagccaacagagaaaattgagtggagtcattagagaaaccttgcaagct
tctcagactcaactggaagaagccaaagctaagaaggatcggctagtggcccagctgaag
ggtgtgcagaacatgctagccatggacagagatgacacaagtgagaagatcgcccgtgcc
aaggcagtggccacagaagccaatgacacagccacacaggtgggcgccacactgagggac
atggagaggaatctgcatcggtggcagggacagtatggggacctgaagaaccaagacctg
gtccaggccatggaagatgctgggaaatcagtatccagtctagagaagaccctgcctcaa
ctgctggccaagctaagccagctagagaacaagagaggccagaatgccagtctggccctc
tctaccagcatcttacgtgtacgggagctcatcacccaggcccgcagtgctgcaagcaag
gtgaaagtgtcgatgaagttcaatggccgttcaggggtgcagctgcggcccccccgggac
ctgcaggatctggctgcgtacacagctctcaagttctatatccagagctcagagccacct
caacagcagggccaggatggcagcagccaatttgtcctctatatgggcagtcgtgaggcc
tctggagactacatgggggtgatcctgcatgagcacaaggtgcagtgggtgtaccggctt
ggggaggcggcccacaggaccctgaccatcgatgaggacatcagggagcagtttgctact
gtcagcatcgacaggatccttcagtatggtcacatgtctgtcacagtggagaagcagaca
gtacatgagactaagggagatagtgtgtaccctggggaccaaggtctgctcaacctgaga
ccccaagactttgtcttctatgtgggaggctacccttccaacttcacgcctcccaggccc
ctgcagtaccctggttaccggggctgcattgagatggacaccctgaatgaggaggtcgtc
agtctttataacttccagaggaccttccatctggacacggccttggacaaaccgtgtgcc
agatctaagtccacgggggacccctggctgacagatggttcctacctggacggcacgggc
ttcgcacatatcagctttgagagtcagatcagcagcaccaagcgctttgagcaggaactg
agactggtctcctacactggcatcatcttctttctccagtaccaggaccagttcgtatgt
ctggctgtccaggaaggccacctcatcctctactatgatttcaaccatgggctgcagatt
gccaccccccaacaggagctgacaccccttacctcgtccaacaaagcgatccagattttc
atcatgggtgtgacaggccgaaagcgggtcctggtccgagtggagcgagtgtctgtcttc
agcttgcaggaggagaatatgctggagaatgctgactcctattacctgggaggagttcct
ccagaccaacttcctccaagcctaagatccttgttccccactggggggtcaatccgaggc
tgtgtaaagggcctgaaagcccttggcaaatatgtggacctgaagagactgaacacaaca
ggcatcagctcaggatgcacttctgacctcctgattacacgatccatgaccttccatggg
catggctacctgaccttggccctcagagatgtgccccctattactggaaacttctacaca
ggttttggcttccgttccacacaggacaacggtcttctctactatcatgcctcaccggag
ggtattttccaggtgtcgctaagacagggccgcgtgatactcaagttcctcaggacagag
gtcatgacgagagttgcttatgctgatggggtttctcactatgttgcaatctacagtaat
gacacaggggtctggctgtatgtggatgatcgacttgaaggtgcagagcaccaggggggc
cggtctcgtcgtcaggctgcagccgagggtcctcctcgcttcctccttggggggctgcct
gagtctggtgccttccaaaacctgactggctgtatcagcaatgtctttgtccggcgggta
tcagaggcccagcgtgttgtcgacctgcagcagaatatccagaatgtcaacgtgaccaca
ggctgcactcccccagatggaccactccaactcagggcatcaccaaggaagttccgaagg
aaacccaaggctgctctccatgaccaagggatgcccccagactctgcttgccagtttccc
acccatcccaaaaccatcagcaatgcctaccagtttggggcttctcctgccagccgtctg
gagtttgctcacatcccatcctctttccaggatcggacccacttctctatggatgtccag
cttcgctcacctcgtgggctacttctggctgtgccaactgtaaagtcgggaagccccttc
ctggtcctctacctcagtcatggccgctttgtcctccaggctggaggccacggaaaacct
ttacgagtccgtagccaggagcgatacaagccaggaggctggcatacggtctttttcagc
caagagcagaatcgagttcagctggtgatcgatgggcttcgggctcagagcagtgaaggg
cctcgtgcctaccggagggcattgctgggccatggaccaatctatgtgggtggcgtcccc
tctggccagagctggactcatctcccagaagcagctggcacaagctttaaaggatgcatg
aggaacctgaagctgaatggacagcctctggagaccccaacgcagctccatggagtgata
ccatgttacactgggaccctggagaagggattattctttgctgcagaagggggaactgta
acgttggatctccccgaggtgtgggggccagacctggagctggtgctggaggtgcgtccc
cgggcagcacttggactcatctttcacctagggccaaggcagggaccaccctatatcaga
cttgaagcagatggggacaaggtgattgtcagagccaacaatggggcaggggagttctcc
acatcagtgactcggcctcctctctgtgatggacagtggcaccggattgcagtgattaaa
agaagaaaagtggtccagctggaggtggatacagaaggcaattacacagtggatcctgcc
ttagttccttccattatcaccaaagaacctctttacctgggaggtctaccagagactttg
aagcacatggttccaccatcatctcaacctggttactatggctgtatgaggaatcttgtg
gcaaaccgtcgccttatcaacctgacacacaatggcattatccaaggctcagtgggtgca
agaggctgcccagtcatgtaa

KEGG   Phascolarctos cinereus (koala): 110206842
Entry
110206842         CDS       T05867                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05020  Prion disease
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110206842 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110206842 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110206842 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110206842 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110206842 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    110206842 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110206842 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110206842 (LAMC1)
   05145 Toxoplasmosis
    110206842 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 110206842
NCBI-ProteinID: XP_020840030
UniProt: A0A6P5K496
LinkDB
Position
Unknown
AA seq 1601 aa
MRGSPPRPLAALAPLLAAALLAGWAAAAMDECADEGGRPQRCMPEFVNAAFNVTVVATNT
CGAPPEEYCVQTGVTGVTKSCHLCDAGQPHLAHGAAYLTDYNNQADTTWWQSQTMLAGVQ
YPSTINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTQEDGPWIPYQYYSGSCENTYLK
PNRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATD
IRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNNFDKLVCHCK
HNTYGVDCEKCLPFFNDRPWRRATAESASECLPCNCNGRSQECYFDPELYRSTGHGGHCT
NCQGNTDGANCERCRENFYRLGNEEACQPCHCSPVGSLSTQCDNYGRCSCKPGVMGDKCD
QCQPGFHSLTEAGCRPCSCNPAGSTDECNVETGRCICKDNVEGFNCERCKPGFFHLESSN
PRGCTPCFCFGHSSVCTNAEGYSVHSITSTFQIDKEGWRAEQRDGSEASLQWSSESQEVS
VISDSYFPIYFIAPDKFLGNHLLSYGQNLTFSFPVERRDTRLSAEDLVLEGAGLRVSVPL
IAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYSERSAGYL
DDVTLTSAQRGPGVPAVWVESCTCPLGYGGQFCQLCVSGYKRETPSLGPYSPCVLCTCNG
HSETCDPETGVCNCRDNTAGPHCEKCADGYYGDSTTGSSSDCQPCPCPGGSSCAVVPKTK
EVVCTNCPTGTTGKRCELCDDGYFGDPLGENGPTRLCRPCQCSDNIDPNAVGNCNRLTGE
CLKCIYNTAGFYCDRCKDGFFGNPLAPNPVDKCKACSCNPYGTVNQQTTCNQVTGQCECL
PHVTERDCSACDPGFYNLQSGQGCERCNCHALGSTNGQCDIRTGQCECQPGITGQRCEQC
EPNHFGFGPEGCKPCDCHPEGSVSLQCKDDGRCECKEGFVGNRCDQCEENYFYNRSWPGC
QECPACYRLVKDKVAEHRVKLQELENLIANLGTGDETVTDQAFEDRLKAAERDVMDLLQE
AQDIKDIDQNLMDRLQRVNNTLSSQISRLQNIRSTVEETGNLAEQARTRVESTERLIEIA
SRELEKAKVAIANVSVAQPDSTGDPNNMTLLAEEARKLAERHKKEADDIVRVAKTANDTS
TEAYNLLLRTLAGENQTANEIEELNRKYEQAKNLSRDLEKQATRVHEEAKRAGDKAVEIY
ASVAQLTPVDSVALENEANKIKKEAEALDQMMDKKLRDYEDLREDMKGKELEVKDLLDKG
KTEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKTAAEEAL
KKIPAINRTIAEANEKTREAELALGNAAADATEAKTKAHEAEKIAGAVQKNATSTKAEAE
RTFADVTSLDKEVDEMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKAKN
SVSSLLTIINDLLEQLGQLGTVDLNKLNEIEGTLNKAKDEMRISDLDRKVSDLENEAKKQ
EAAIVDYNRDIEEILKDISNLEDIKKSLPSGCFNTPSIEKP
NT seq 4806 nt   +upstreamnt  +downstreamnt
atgcgcgggagcccgccgaggcccctggccgcgctggccccgctgctggcggccgcgctg
ctggcgggctgggctgcggcggccatggacgagtgcgcggacgagggcgggcggccgcag
cgctgcatgcccgagttcgtcaacgccgccttcaacgtgaccgtggtggccaccaacacg
tgcggcgccccgcccgaggagtactgcgtgcagaccggggtgaccggggtcaccaagtcg
tgtcacctgtgcgacgccgggcagccccacctggcgcacggggccgcctacctgaccgac
tacaacaaccaggccgacaccacctggtggcagagccagaccatgttggccggggtgcaa
taccccagcaccatcaacctcaccctgcacctgggaaaagcctttgacatcacatatgtg
cgcctgaagtttcacaccagtcgccctgagagttttgctatctacaaacgtacccaggaa
gatgggccctggattccgtaccagtactacagtggctcctgtgagaatacctacttgaag
cccaaccgaggtttcatcaggacaggtggagatgaacagcaagcattgtgcactgatgag
ttcagtgacatttctcctctcactggaggcaacgtggccttttcaactttggaaggaagg
cccagtgcctacaactttgacaacagccctgtgttgcaggaatgggtaacggccacagac
atcagagtaaccctcaatcgcctgaatacttttggagatgaagtgtttaacgaccccaaa
gttttgaagtcttattattatgcaatttctgattttgctgtgggtggcaggtgtaaatgc
aatggacatgcaagtgagtgtgtgaagaacaactttgataagttggtatgtcattgcaaa
cacaacacctatggagtagactgtgaaaagtgtcttcctttctttaatgaccggccatgg
aggagagcaacagcagagagtgccagtgaatgtctgccttgtaactgcaatggaagatca
caagaatgttactttgaccctgaactataccgttctacaggccatggtggccactgtacc
aactgccagggtaatactgatggtgccaattgtgagaggtgtcgggagaatttctatcgc
cttgggaatgaggaagcatgccagccatgtcattgtagccctgttggctctctcagtaca
cagtgtgataattatggacgatgtagctgtaagccaggtgtgatgggtgacaaatgtgat
cagtgccagcctggattccactctcttactgaggcaggatgcaggccttgttcttgcaat
cctgctggaagtacagatgaatgtaatgttgaaactgggcgttgtatttgtaaagacaac
gtggaaggattcaactgtgagaggtgcaaacctgggttttttcacttggagtcatccaat
cctcgaggctgtaccccttgcttctgttttgggcattcttctgtctgcacgaatgcggaa
ggatacagtgttcactccatcacctctactttccagatagataaggaaggatggcgtgct
gaacagcgagatggctctgaggcttcactccagtggtcttctgagagccaggaagtatct
gtgatctcagatagctactttcccatatacttcattgcacctgacaagtttttaggtaac
cacctgttgagttatggtcagaatctcactttctcctttccggtggaaaggcgggataca
cgactctctgcagaagatctggtccttgaaggagctggtcttagagtatctgttccctta
attgctcagggcaactcctatccaagtgagaccactgtgaaatacgttttcagacttcat
gaagcaacagattatccctggagacctactcttactccttttgaatttcaaaaactacta
aataatttaacttctatcaagattcgtgggacatacagtgagagaagtgctggatatttg
gatgatgtcactttgaccagtgctcagcgtggacctggggtccctgcagtttgggtagag
tcctgtacctgccctctgggctatggagggcagttttgtcaactgtgtgtctcaggatac
aaaagggagacacctagtcttggaccttacagtccttgtgtgctttgtacctgcaatgga
catagtgagacctgtgatcctgagacgggtgtttgtaactgcagagataacacagccggt
ccacactgtgaaaagtgtgctgatggctactatggagattcaacaactggttcttcctct
gattgtcagccttgtccatgcccaggaggctcaagttgtgctgttgtgcccaagacaaag
gaggtggtatgcaccaattgtcctactggcaccactggtaaaaggtgtgaactttgtgat
gatggctattttggagaccctcttggtgaaaatggccccacaagactttgccgaccttgt
cagtgcagtgacaacattgatcccaatgcagttggaaattgcaaccgcttaactggagaa
tgcttgaagtgcatctataacactgctggcttttattgtgaccgctgcaaagatgggttt
tttggaaatcccctggcccccaatccagtagacaagtgcaaagcttgtagttgtaatcct
tatggcactgtgaatcagcagactacttgtaatcaagtaactgggcagtgtgagtgcctc
cctcatgtcactgagagggattgcagtgcctgtgatcctggattctataatctacagagt
ggacaaggatgtgagagatgtaactgtcatgctctcggttctaccaacggccagtgtgac
atacgcactggccagtgtgaatgtcagccaggcataactggtcagcgctgtgagcagtgt
gaacccaaccactttggtttcggacctgaaggctgcaaaccatgtgactgtcaccctgag
gggtctgtttcactccagtgcaaagatgatggtcgttgtgaatgcaaggagggttttgtg
ggaaatcgctgtgaccagtgtgaagaaaactatttctataatcggtcttggcctggctgc
caggagtgtcctgcatgctacagactagtgaaagataaagttgctgagcatcgagtgaag
ctccaggaattagagaaccttatagcaaacctcggaactggagatgaaacagtcacggat
caagcctttgaggacagactgaaggcagcagagagagatgttatggaccttctgcaggag
gctcaggacatcaaagatatagaccagaacctgatggatcgcctccagagggtgaataat
accctgtccagccaaatcagtcgcttacagaatatccggagcactgtggaagagacagga
aatttagctgagcaagcccgcacacgagttgagagcacagaaaggctcattgaaattgct
tccagagaactggagaaagcaaaagtggccattgccaatgtgtcagttgctcaaccagat
tctactggggatcctaacaacatgactctattggcagaagaggctcgtaaacttgctgaa
cgacataaaaaagaggctgatgacatcgtacgagtagccaagacagccaatgatacatca
actgaagcctataatctgctcttgaggactttggccggagagaatcaaacagcaaatgaa
attgaagaacttaataggaaatatgaacaagcgaagaacctctcccgagatctggagaag
caggctacccgagtacatgaagaggcaaaacgagctggagacaaggctgtagagatttat
gctagtgttgcccagctaacacctgtggattctgtggcccttgagaatgaggctaataag
ataaagaaggaagcagaggccctggaccaaatgatggacaagaagctaagggactatgag
gacctccgggaagacatgaaaggcaaggagcttgaggtgaaggacctcctggacaaagga
aagaccgagcagcagacagctgaccaactcttggcccgagctgatgctgccaaggctctt
gctgaggaagctgctaaaaaggggagaaatacattacaagaagccaatgatattctcaac
aacttgaaagattttgatagacgagtaaatgataacaagacagcagcagaggaggcccta
aagaagatccctgccatcaaccggacaattgctgaggccaatgaaaagacacgagaggca
gagctggccctgggcaatgcggctgcagatgccactgaagccaaaaccaaagcccacgag
gcagagaagatcgcaggggctgtgcagaagaatgccaccagtaccaaagcagaggcagaa
agaacttttgcagatgttacgagtttggacaaagaggtggatgaaatgttgaaacagtta
caagaagcagaaaaggaactgaagaaaaagcaagatgacgctgaccaagatatgatgatg
gcaggaatggcttcacaggctgctcaggaagcagagattaatgcaagaaaggctaagaac
tctgttagtagccttctcaccatcatcaatgacctcttggaacaacttgggcagctgggc
actgtagacctgaacaagctgaatgagatcgaaggcactctgaacaaagccaaagatgaa
atgaggatcagtgatctcgacagaaaagtatctgatctggaaaatgaagccaagaaacaa
gaggctgccattgtggactacaacagagatattgaggaaatcttgaaagacattagcaac
ctagaagacatcaagaagagcttgccatcgggctgcttcaataccccctccattgagaaa
ccctaa

KEGG   Phascolarctos cinereus (koala): 110206843
Entry
110206843         CDS       T05867                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110206843 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110206843 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110206843 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110206843 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110206843 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110206843 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110206843 (LAMC2)
   05145 Toxoplasmosis
    110206843 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B MCPsignal
Other DBs
NCBI-GeneID: 110206843
NCBI-ProteinID: XP_020840031
UniProt: A0A6P5K5Q1
LinkDB
Position
Unknown
AA seq 1190 aa
MSPLWLRCLCFSFLLPAALGTSRKEVCDCNGKSRQCIFDQELQKRTGKGLRCLNCNDNTA
GVHCERCKDGFYRQRDRDRCLPCNCNTKGSLSSRCDNRGRCSCKSGVMGDRCDQCQPGFH
TLTEAGCTRNRQPKDSKCDCDPAGSTGSCDSGRCVCKASVTGERCDRCRPGYYHLDKSNP
EGCTQCFCYGHSATCSSSGVYSVYKITSTFHRDADGWRAIHRNRAPAPLQWSQRHHDVFS
TARRSDPIYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRVSAPLM
PLGKTLPCGITKTYTFKLNEHPSSKWNPQLSYFEYRRLLRNLTALWIRATYGDYSTGYID
NVTLISARPISGAPAPWVERCVCPAGYKGQFCQECAPGYKRDSAKLGPFGSCIPCNCQGG
GACDPDTGDCYSGDENPDIDCADCPIGFYNDPQDPRSCKPCPCQNGFSCSVMPETEEVVC
SNCPQGITGARCELCADGYFGDPFGENGPVRPCQPCQCNNNIDPSAPAKCDHLTGECLKC
IYNTAGFHCDQCKEGYFGNPLATNPSDKCRACNCNSVGSEPQRCRSDGSCICKPGFGGVN
CDHSASTSCPTCYNQVKIQLDQYSQQLQSLEALVLKVQAGGGSLHNAELEGRLKEAEGTL
QDILREAQISEDSSRSLKLRLDKAKAQETNYQSRLDELKMTVGRMLALENQYRSQVQDTR
RLIAKMRLNLEESKTSLSNTNIPPSDQYEGPNSFKALAQEAWKLADSHVKSANDMERLAG
ETRDYSNQALEMVRKAVTDGVGSSSVDSSVVQGLVGKFEEVKSLAQQLQREASQGDTEAE
TSYQQSLSLLNSMPQRLGITNQAFQVETKRIRQEADSLSSLVTGHVTEYKHLQERLGDWE
EETRQLLQDGEKESQKSDQLLSRANLAKSRAEEALSMGNATFYEVESILKNLREFDLQVE
DRKAEAEDAMRRLPLITQMVADANDKTGQAERALGSAAADARRAKSMAGEALEISDNIEQ
EIGRLNLEANTTADAALALEKGMATLSSGIRDVEGELGRKELEFDQDGNTMQMVIQDAQG
ANSRAQNAGFAIQNTLNALDSILNLIDQPGSVDEEGLILLEQNFSKARNQINTQLRPLML
ELEDRVRQQQGHLRFLEANIDGILADVKNLEDIRNNLPPGCYNTQALEQQ
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgtctccgctctggctgaggtgcctctgtttttctttcctcctgcctgcagccctgggc
acctctaggaaggaagtctgtgactgtaatgggaagtccaggcaatgcatctttgatcaa
gagctgcaaaagaggacaggaaagggactccgctgcctcaactgtaatgacaatacagct
ggtgtccactgtgagaggtgcaaggatggattttaccgccagagagacagagaccgctgc
ttaccttgcaattgcaacaccaaaggctctctcagctcacggtgtgataaccgtggacga
tgcagctgtaagtcaggtgtgatgggagacagatgtgaccaatgccagccaggattccac
actctcactgaagctggatgcacccgcaatagacaaccaaaagattccaaatgtgactgt
gatccagctggtagcacagggagctgtgactcaggtcgatgtgtctgcaaagcttccgtc
actggagaacgctgtgataggtgtcggcctgggtactatcatctggacaaaagcaaccct
gaaggatgtactcaatgcttctgctatggccactcagccacctgcagcagttctggggtt
tacagtgtctacaagatcacttctactttccatcgagatgctgatggctggagggctatc
cacagaaacagagcccctgcaccgcttcagtggtcacaacgccaccacgatgtgtttagc
acagcccggagatctgatcctatctattttgtagctcctgccaaatttcttgggaaccaa
caggtgagttatggacagagcctatcttttgactaccgtgtggaccgaggagggaggcac
ccttctgcccatgatgtgattctagagggagctggtcttcgtgtctcagcccctttaatg
ccacttgggaagacattgccgtgtggaatcaccaagacatacacattcaaattgaatgaa
catccgagcagtaaatggaatcctcagctgagttattttgagtaccgaaggttattacgg
aacctgacagccctttggatcagagctacatatggagactacagcacaggatacattgat
aatgtgacactgatatcagctcgtcccatctctggggccccagcaccctgggttgaaaga
tgtgtatgtcctgctgggtacaagggacaattctgccaagaatgtgcccctggatacaaa
agagattctgccaagcttggaccttttggaagttgtataccatgtaactgtcaaggtgga
ggagcctgcgacccagacactggagattgctattcaggggatgaaaacccagacattgac
tgtgctgactgccccattggcttctataatgatccccaggacccccgcagctgcaagcca
tgcccttgtcagaatgggttcagctgctccgtgatgccagagacagaggaagttgtctgc
agtaactgcccacaagggatcactggtgctcgctgtgagctctgtgctgatggctacttc
ggagatccctttggtgaaaatggtcctgtaagaccatgccagccctgtcagtgcaacaac
aacattgaccccagcgcacctgcaaagtgtgatcacttgactggggagtgtttgaaatgc
atttataacacagccggcttccattgcgaccagtgcaaagagggctactttgggaatcct
ctggctactaatccatcggacaaatgtcgggcttgtaattgcaactcagtgggatctgag
cctcagaggtgtcgaagtgatgggagctgtatctgcaagcctggatttgggggcgtcaat
tgtgaccattcagcctcaaccagctgtccaacctgctacaaccaagtgaagattcagttg
gaccagtactcgcagcagctgcagagtttggaggctcttgttttgaaggtgcaggctggt
ggtgggtccctacacaatgcagaactggaaggaaggctgaaggaagcagaggggaccctt
caggacattctgagagaagctcagatctctgaagactccagtaggtccctaaagctccgc
ctggacaaggcaaaagcccaagagaccaactaccagtcacgactggatgagctcaaaatg
actgtgggcagaatgctggccctggagaatcagtatcggagccaagtgcaggacacccgg
aggctgattgccaagatgagattgaatctggaggaaagcaaaacatctctaagcaacact
aacatcccaccttcagaccagtatgaaggaccaaacagctttaaagccctagcccaagag
gcttggaagttagcagacagtcatgtaaagtcagctaatgatatggaacgactggctggg
gaaaccagggattattctaaccaagccttggaaatggttcgcaaagctgtgacggatgga
gtgggaagcagcagtgtggacagttctgtggtgcaagggctggtgggaaaatttgaagaa
gtcaaatccctggcccagcagttgcagagggaggccagtcaaggtgacactgaagcagag
acatcttatcagcagagcttgagcctcctgaactccatgcctcaacgcctggggatcact
aaccaggccttccaggtggaaacaaagagaatcagacaggaagctgattctctgtcaagt
ctggtaacaggacatgtaactgagtacaagcatttgcaagagcgcctgggagactgggag
gaagaaacacggcagctgttacaggatggagagaaggagagccagaaatcagatcagctg
ctttcccgtgccaatcttgctaagagcagagctgaagaggccctgagcatgggcaatgct
actttttatgaagttgagagcattttaaagaacctcagggaatttgacctgcaggtcgag
gataggaaagcagaagcagaagatgctatgaggagactccctttgatcactcagatggtt
gcagatgccaatgacaaaacaggacaggcagagagggccctgggcagcgccgctgcagat
gccaggcgggcaaagagcatggcaggagaagcgctagagatcagtgataatattgagcag
gagatagggagattgaacttagaagctaacacaacagcagatgctgccttggcactggag
aaggggatggccactctgagcagtgggatccgggatgtggagggagaacttggaaggaaa
gaactggagtttgatcaggatgggaacaccatgcaaatggtaattcaggatgcccaaggg
gctaattccagagcccaaaatgcaggatttgccatccaaaatacactaaatgccttggac
agcatcctgaatctaatagaccagcctggcagtgtggatgaagaagggttaatcttacta
gaacagaacttcagcaaagccagaaaccagatcaacacccagcttcgtcccttgatgttg
gaactggaggacagagttcgtcagcagcaaggccaccttcgattcctggaggccaacatt
gacgggatcctggctgacgtcaagaacttggaggatattcgcaacaacctgcctcccggc
tgctacaatacacaggctcttgagcagcagtga

KEGG   Phascolarctos cinereus (koala): 110206931
Entry
110206931         CDS       T05867                                 

Gene name
LAMB4
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit beta-4
  KO
K06245  laminin, beta 4
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110206931 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110206931 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110206931 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110206931 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110206931 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110206931 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110206931 (LAMB4)
   05145 Toxoplasmosis
    110206931 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N
Other DBs
NCBI-GeneID: 110206931
NCBI-ProteinID: XP_020840118
UniProt: A0A6P5K463
LinkDB
Position
Unknown
AA seq 1772 aa
MKFQLTFLMHLVLFRLAKAQDDCNSGSCHPIVGDLLVGRSAQLTASSTCGLDEPQKYCII
GYLEDEQKCFICDSRYPYNPYTQANSHTIENVITTFEPERKKKWWQSENGLNNVSIRLDL
ETLFQFSHLILTFKTFRPAAMLVERSVDYGQTWKVFRYFAKDCAASFPNIPSGQAQGVDD
LVCDSKYSDIEPSTEGEVVLKALDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRPTDPLDKYYYALYDMVVRGRCFCNGHANRCGPVQDVRGDVFSPSGMVHGQCICQHN
TDGPNCERCKEFFHDVPWRPAEGLQDNACRSCNCNGHSERCHFDMSLYLSSNGVSGGVCE
DCQHNTVGQHCDQCKPLFYRDLLKAISDPHACIPCECDPEGSLSGGMCESYPNPALGIEA
GRCLCKDNVEGAQCDQCKPGYYGLNANDPLGCQPCNCNPFGSVPFSTCDVVTGQCFCQQF
ATGLHCEECLVGYWGLKNNLRGCSPCDCDIGGAYSNLCSPHDGQCECRPHIIGLQCTEPE
PGYFFVPLDFYIYEAEDAMPISGSAPLILATAIPHCEVYFQKQGGGFTIDRGNIILERNK
IQSSQEQSEVLSGTSLRFTINNIPYAMDYAIAIRYEPQSSADWEARIVINPSGTSRGEHC
RYKVLPQEPQTLALPASVRIALLATPVCLEPEMQYSVDVHFSQSFTTDSQAHGHILIDSL
GLIPQIDSIENFCNKQHLDEHQLNNCIEIASKPHPQILPDWCERLIVSISARIHNGAVAC
QCHPQGSIGSSCSKLGGQCQCKAXVVGCCCDQCSAGAYGLGHHGCHSCECHPQGSNSTMC
DQVTGQCPCHRDIEGRRCDRCLAGYFGFPNCRPCPCNGFAELCDPETGSCFNCRGFTAGH
NCERCIDGYYGNPLSGKPCLPCQCPDAPSSNQYFAHSCYQNSWNLEIICNCQEGYTGIKC
DECSTGFYGNXRITGGLCLPCVCNNNIDRTDPQSCNRVTGECLKCLYNTHGPNCQFCKPG
YFGSALTQNCRKCDCNPSGVNLTTCPVGDGACLCDPTTGSCPCLPNVIGLACDQCAKGYW
NLVLGRGCQFCECDPQHSHNNHCNQFTGQCPCKLGYGGKHCNKCEENYYGDPQMQCIECK
CNKEGTQXPICDQETGSCLCRTGVVGQFCDRCARGHSQEFPTCLRCHLCFDQWDSKISSL
SDAVQGLIRLAANLEDKRETLPGCNADFKRLGDSMSEIERILKHPVFSSGEFLNVKDYHD
SVRTQVDQIAQQLNRAYDFQDLNGTVVGIGKEVDDLLKDLQKKVHLASHVSNSSIRDASK
IKKYYQMSLSAEQKINETTLIIKHSENTRNDMLTMIDGLTSKADFSLKKLKQIQTPDIQK
LNEKVCGIPGNLSCVLAPCGGALCKDAYGHRMCGGPSCNGSLGLSEDAVKKAEETESMIN
NLTNQLQVSENQIRNITKLTQLTKTKALQLTEKLENMKDQIELEEQKTKALLHNVKDFLL
DENVPPEDIEKVANHVLDLHLPITSQNLTKELDKIELLTKLCEDDHAAEGRLKLKATEAQ
KLLAKSKEAEEAVNTLLNLEEMLGNLQHAEGVQGRANSAVKNLTDEIQKIEMTILKAENF
TSKTNDELEHISSQQSTLEDEISTLQTKIQRTRDGAISAKAQAESVQDQANITEKDFIDL
KRQFTVLQDKANSKGSMKGTLSKVKQLKEEAEKLAGETEEKMQRIKDLAKKIQILNQTKQ
EKVNQLKQLENHVIAIKNEIAEQENKYATCHI
NT seq 5319 nt   +upstreamnt  +downstreamnt
atgaaatttcagctgacctttttaatgcacctcgtgctgtttagactcgcaaaagctcaa
gatgactgcaacagtggctcttgtcatccaatcgttggtgatctcctagtgggtcgcagt
gcccaacttacagcctcctctacctgtggattggacgaaccacagaaatactgcatcata
ggctacctggaggatgaacaaaaatgtttcatttgtgattccagatatccatataatcca
tatacacaagccaacagccatacaatcgagaatgtcattacaacatttgaaccagagaga
aaaaagaaatggtggcaatctgaaaatggtcttaataatgtcagcatcagactggaccta
gagaccctgtttcagttcagccatcttatattgacctttaagactttccgacccgcagcc
atgctagttgagcgttccgtggactatggccaaacatggaaagttttcaggtattttgca
aaagactgcgctgcatcttttcccaacatcccatctggccaggcacaaggagtagatgac
cttgtttgtgattccaagtattcagatattgaaccctctactgaaggagaggttgtttta
aaagctttggatcccagctttgaaatagaaaatccctacagcccctacatacaggatcta
gtgactcttacaaacctgaggataaactttaccaaactacacactctgggggataccttg
cttggaagaaggccgactgatcccctggataagtattactatgctctttatgatatggtt
gttcggggaagatgcttttgcaatggccatgctaacagatgtggccctgtgcaggatgtc
cggggagatgtcttcagcccatctggaatggttcacggtcagtgtatctgccagcacaat
acagatggtccaaactgtgagagatgcaaggaattcttccatgatgttccctggaggcca
gccgaaggtctccaggataatgcttgcagatcatgtaattgtaacggccactctgaacgc
tgtcactttgatatgtcactgtacctctcaagtaatggtgtcagcggtggagtgtgtgaa
gactgtcagcacaatactgtgggacaacactgtgatcagtgcaaacccctgttttacagg
gacctcctcaaggcaatttcagaccctcatgcttgcattccttgtgagtgtgatcctgaa
gggtcactgtctggtggcatgtgtgaaagttatccaaatccagccctgggaatcgaggct
ggtcgatgcctttgtaaagacaatgttgagggagcccagtgtgatcagtgcaagcctggc
tattatggactgaatgccaatgatcctttgggttgtcaaccctgcaactgtaaccccttc
gggagtgtaccattctccacctgtgatgtggttactggccagtgtttttgccagcagttt
gctactggactccactgtgaagaatgcctcgttggatattggggacttaaaaataatcta
cgtggttgttctccttgtgactgtgatattgggggtgcttatagcaacctgtgttccccc
catgacgggcaatgtgaatgccgccctcatattattggcctccaatgcacagagccagaa
cccggctacttctttgtgcctttggatttctatatctatgaagctgaggatgccatgccc
atctctggatctgcacctttgatactagcaacagctataccccactgtgaagtttatttc
caaaagcaaggaggtggtttcacaattgaccgtggaaatataatattggagaggaataaa
atacaaagttcacaggaacagagtgaagttctcagtgggaccagcttgagattcaccatc
aacaacatcccctatgctatggactatgctattgcaattcgttatgagcctcagtcgtca
gctgactgggaagctcgcatagtgattaacccttctggaacttcaagaggtgaacattgc
agatataaagtactcccacaagagcctcagactctggccttaccagcttctgtaagaatt
gcactgcttgccacaccagtctgcctagaaccagaaatgcagtattctgtagatgttcat
ttttctcagtcatttactacggattcacaggctcatggacatattttgattgattcgctt
ggccttattccccaaattgattcaatagagaatttctgcaataaacaacatttagatgag
caccaactaaacaactgtatcgaaattgcttccaaaccacatcctcaaattttgcctgac
tggtgtgaaagacttatagttagcatatctgcaaggatacacaatggagcagttgcatgc
cagtgtcaccctcagggttccatagggtcaagctgcagcaaactgggaggccagtgtcaa
tgtaaagccnacgtggtggggtgctgctgtgatcagtgttctgcgggagcctatggtttg
gggcaccatggttgtcactcatgtgaatgccatcctcaaggctccaacagcaccatgtgt
gatcaggtgacaggacagtgcccctgccacagagacatcgaaggtcgccgctgtgatcgg
tgcttggctggttattttggatttcccaattgccgtccttgtccctgcaatgggtttgcg
gaactttgtgacccagagactgggtcatgcttcaactgcagaggatttacagctggacat
aattgtgaaagatgcattgatggttactatggaaatcctctctctggaaaaccatgtctt
ccttgccagtgtcctgatgctccttcaagtaatcagtattttgcccattcctgctaccag
aattcttggaatttagaaataatctgcaactgccaagagggttatacaggtattaaatgt
gatgaatgctcaactggtttttatggaaatnngagaataacaggaggcctttgtctacca
tgtgtctgcaataacaatatagatagaacagatccacaatcatgcaacagggtaacagga
gaatgccttaaatgtttatataacactcatggacccaactgccagttctgtaaaccaggt
tactttggatcagcactcacacaaaattgcagaaaatgtgattgcaatccttctggggta
aaccttactacctgtccagtgggtgatggagcatgcctatgtgacccaacaacaggatcg
tgtccttgcttgccaaatgtcataggtttggcctgtgaccaatgtgccaaaggatactgg
aatctggtccttggtagaggatgtcagttctgtgaatgtgacccccaacattctcataat
aatcactgtaaccagtttacgggccagtgcccttgtaaattgggatatggcggaaaacat
tgcaacaaatgtgaggaaaattactatggagatccccagatgcaatgcattgaatgtaag
tgtaacaaggaagggacacagnaacccatctgtgaccaggaaactggttcctgcctgtgc
cgaacgggtgtcgtgggccagttctgtgatcgttgtgcccgtggtcattcccaggaattt
cccacttgtcttcgatgtcacttgtgctttgatcaatgggacagtaagatttcttccctc
tctgatgctgtacaagggttaattagattggctgcaaacttggaggataaaagagagacc
ctgcctggctgcaatgcagacttcaaacgcctaggagatagcatgtctgaaatagaaagg
attttgaaacatcctgttttctcatctggggaattcttaaacgtcaaggattatcatgac
tcagttagaacacaggttgatcagatagcccaacaactgaatagagcttatgatttccaa
gacctgaatggaactgtggtgggcattgggaaagaagtggatgatctactcaaagacctg
cagaaaaaagtgcacttggcctcccatgtcagcaattccagcatcagggatgcctccaag
atcaagaaatattatcagatgtcattatctgcagaacagaaaattaatgagacaacgctt
atcataaaacattctgaaaatactaggaatgatatgcttactatgatagatggactaacc
tcaaaagcagacttctcactgaaaaaattaaaacagattcagactccagatatccaaaaa
ctgaacgaaaaggtgtgtggaataccaggaaacttgtcatgtgttcttgcgccctgtggg
ggagctctgtgtaaagatgcttatgggcacaggatgtgtggaggtccaagctgtaatggt
tctctaggcctttcagaggatgctgtcaagaaagctgaagaaactgagtctatgattaat
aatctgaccaaccagctacaagtatcagagaatcagataagaaacataacaaaactaact
caactcactaagaccaaagctttgcagctaactgagaagctagagaatatgaaagaccaa
atagagctggaagaacagaagacaaaagccctcctccacaacgtgaaggactttctgcta
gatgagaacgttccaccagaagacatagaaaaggtcgcaaatcatgtcctggacctccac
ctcccaataacttcacaaaatctaactaaggagcttgataaaatagagctgcttacaaaa
ctctgtgaggatgaccatgcagcagagggcaggctaaaactaaaagccacagaagcccag
aaacttttagcaaagtctaaagaagctgaggaagcagtaaacaccctactgaacctggaa
gaaatgctgggaaacttgcaacacgctgaaggtgtccaagggcgagcaaactctgctgtt
aaaaatctgactgatgagatacaaaaaattgaaatgaccatactgaaggctgaaaacttc
accagtaagactaatgatgaattggaacacatatcaagccaacagtctacactggaagat
gaaatctctaccttgcaaaccaagatacaaaggactcgagacggtgctatcagtgcaaaa
gcccaggcagaatcagtccaggatcaagctaacatcactgagaaggatttcattgaccta
aaaagacaatttacagttcttcaagataaggcaaactctaaaggatccatgaagggaaca
ctcagtaaagtaaaacagctaaaagaagaagcagaaaaattggctggggagacggaggaa
aaaatgcaacgaataaaagatttagcaaagaagatccagatcttaaatcaaaccaagcaa
gagaaagtcaatcaactaaagcaactagaaaatcatgtcatagctattaaaaatgaaatt
gctgaacaagaaaataaatatgcgacctgccacatctag

KEGG   Phascolarctos cinereus (koala): 110207016
Entry
110207016         CDS       T05867                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta-1
  KO
K05636  laminin, beta 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110207016 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110207016 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110207016 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110207016 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110207016 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110207016 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110207016 (LAMB1)
   05145 Toxoplasmosis
    110207016 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 110207016
NCBI-ProteinID: XP_020840254
UniProt: A0A6P5K4S6
LinkDB
Position
Unknown
AA seq 1786 aa
MGLLQVHLFGFLAIWGVRVHAQEPEYSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGVSTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGHSEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSGSCHFDMAVYLATGNTSGG
VCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNICEACTCDPAGSQNGGICDRYTDFSAG
LIAGQCRCKLYTEGEKCDICKEGFYGLSTDDPFGCQPCACNPLGTIPGGNPCDSETGYCY
CKRLVTGQHCDQCLQEHWGLSNDLDGCRPCDCDVGGSLNNNCSAESGQCLCRPHMIGRQC
SEVESGYYFTTLDHYIYEAEEAHFGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRILTSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGVNYTVRLELPQYTSSDSGVESPYTLIDSLVLMPYCKSLDIFTVGG
SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCDRCAPGTFGFGPSGCKPCDCQVQGSINAFCDPVTGQC
HCFQGVYARQCDRCLPGYWGFPGCQPCQCNGHADDCDPISGECFGCQDYTSGHNCERCLP
GYYGDPIIGSGDHCRPCPCPDGPESGRQFANTCYQDPITLQLVCVCNPGYLGARCDECAS
GYFGNPGDVGGVCQQCQCHNNIDTTDPEACEKGTGRCLKCLYHTEGESCQLCRFGYYGDA
LQQDCRKCVCNYLGTVQEHCDGSDCQCDKITGQCLCLPNVIGQNCDHCAPNTWNLASGTG
CEPCSCDVAHSFDPSCNEFTGQCQCMPGFGGRTCNECQELFWGDPNVECRACDCDPRGIE
TSQCDQSTGQCVCIEGVEGARCDKCTRGYSGVFPDCTPCHQCFALWDVIISELTNRTHKF
LEKAKALKISGVIGPYRETVDSVERKVNEIKSILAQSPAAEPLKNIGNLFEEAEKLTKDV
TEKMSEVEVKLSDTASQSNNTVGELDSLQMDAQSLDKTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTIDTNSTVEQSALTRNKVEDLMMEREAQFKEKQEEQSRLLDE
LAGRLQGLDLSAVAEQTCGTPPGALCAETPCGGPNCRTDDGAKKCGGPGCDGLVTVAHNA
WQKAMDFDRDVLSALAEVEQLSQTVSEAKLRADEAKQSAQAVLLKTNATKEKVDKSNEDL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQQSASDIARAEMLLDEAKRASKSATDVKVTADMVKEALEEAEKAQIAAERAIKQADEDI
QGTQNLLTSIESETAASEETLYNASQRINELERNVEELKRKAAQNTEEAGYIGQVVDIVK
QSADDVKKVLDSELSGKYKKVENLIAKKTEESADARKKAEMLQNEAKMLLAQANSKLQLL
KDLEQKYEDNQKYLEDKAQELAKLEEEVRSLLQDISQKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atgggattactccaggtgcaccttttcggtttcctagctatatggggagtcagagtgcac
gcccaagaacccgagtacagttatggctgtgcggagggcagctgctatccagccacggga
gacctgctgattggccgcgcccagaaactctcagtgacctccacgtgcggactgcacaaa
cctgagccctactgcatcgtcagccacctccaggaggacaagaaatgtttcatatgcaat
tcacaggatccttaccatgagacactcaaccctgatagtcatctcattgaaaatgtggtt
acaacatttgctccaaaccgccttaagatttggtggcaatctgagaatggtgtggagaat
gttactatccagttggatttggaagctgaattccatttcactcatctcatcatgactttc
aagacatttcgcccagcggcaatgctgatagaaagatcatctgactttggcaaaacctgg
ggagtgtatagatactttgcatatgactgtgagagttcattcccaggtgtttcaactgga
ccaatgaaaaaagtggatgatataatctgtgactcccgctactctgacatcgagccctct
actgaaggagaggtgatattccgtgctttagatcctgctttcaaaattgaagatccttat
agtccaaggatccagaatctcttaaaaatcaccaacttaagaatcaagtttgtcaaattg
catactttgggagacaacctgttggattccagaatggaaatcagagaaaagtactattat
gcagtttatgacatggtagtacgtggaaattgcttctgttatggacatgctagtgaatgt
gccccagtagatggtcacagtgaagaagttgaaggaatggtacatggacactgtatgtgc
aggcataataccaaaggtttaaactgtgaattgtgcatggacttctatcatgatttacct
tggaggccagctgaaggtcgcaacagtaacgcatgcaaaaagtgtaactgcaatgagcac
tctggctcgtgtcactttgatatggccgtttacttggcaactggcaacaccagtggagga
gtatgcgatgattgccaacataacacaatgggacggaactgtgaacagtgcaagcctttt
tactatcagcatccagagagagacatccgagaccctaacatctgtgaagcatgtacctgt
gatccagctggttctcagaatggtggaatttgtgatcgctacactgacttctctgctggc
cttatcgctggtcagtgtcggtgtaaattatacacagaaggagagaagtgtgacatttgc
aaagaagggttctatggattaagtactgatgatccatttggttgtcaaccctgtgcttgc
aatcctttgggaactattcctggagggaatccttgtgactctgagacaggatattgctac
tgtaaacgtcttgtgacaggacaacattgtgaccagtgtctgcaagaacactggggttta
agcaatgatctggatggctgtcgaccttgtgactgtgatgtagggggatcattaaacaat
aactgctcagccgaatcaggccagtgcctatgtaggccccatatgatcggtcgacagtgc
agtgaagtggaatctggttattacttcacaaccctggatcattacatttacgaggcagag
gaagcccattttggccccggagtcagcatagtggagagacagtatattcaagatcgcata
ccctcctggactggagctgggtttgtcagagtccctgagggagcctatttggaatttttc
atcgacaacattccatattccatggagtacgacatccttattcgctatgaaccacagttg
ccagatcactgggaaaaagctgtcatcaccgtccagcgtcctggaaggattctcacgagt
agccgatgtggtaacaccattcctgatgacgacaaccaggttgtgtcgctgtcaccagga
tccagatatgtggtccttccacgtcctgtgtgctttgagaagggggtgaactacacggtg
aggttggagttacctcagtacacctcctctgatagcggggtagagagcccatacaccctc
attgattcgctggttctcatgccatactgtaaatccctggatatattcactgttggaggc
tcaggagatggtgtggtcactaacagcgcttgggagacctttcaaagataccggtgtttg
gagaatagccgaagtgttgtgaaaacccccatgacagacgtatgcaggaacattatcttt
agcatttctgccctactacaccagacaggactggcttgtgagtgtgatcctcaggggtcc
ttaagttctgtctgtgaccccaacggaggtcagtgccaatgccgtccaaatgttgttgga
agaacatgtgacagatgtgcccctggcacttttggattcggccccagtggttgcaaacct
tgtgactgtcaagtgcaaggttccatcaatgccttctgtgacccagttactggccagtgt
cactgtttccaaggggtctatgcccggcagtgtgaccgatgcctccctggttactggggt
ttccccggctgccaaccttgtcagtgtaacgggcacgcagatgattgtgatcccatttcg
ggagaatgtttcggctgtcaggactacacttcgggtcataactgtgaaaggtgcttgcct
ggctattacggagaccctatcattggttcaggagatcactgtcggccctgcccgtgccca
gatggtccagaaagtggacgacagtttgctaacacctgttatcaagatcctattactttg
cagcttgtgtgtgtttgcaatcctggatacctaggagccagatgtgacgaatgtgcctca
ggctactttgggaaccctggagacgttggtggggtgtgccagcaatgccagtgccataac
aacatcgacacgactgaccccgaagcctgtgaaaaagggactggaaggtgcctcaagtgt
ttgtatcacaccgagggtgaaagctgccagctttgtagatttgggtattacggagacgca
cttcagcaggattgtagaaagtgtgtttgtaattatctgggtacggtgcaggagcactgt
gatggctctgactgtcagtgtgacaagataactgggcagtgcctgtgccttccaaatgtg
attgggcagaactgtgatcactgtgcaccaaacacctggaacctggccagtggtacaggg
tgcgagccctgcagctgtgatgtggcccattcttttgacccatcctgcaatgagttcact
gggcagtgtcaatgcatgcctgggtttggaggtcgaacttgtaatgagtgccaagagctt
ttctggggagatcctaatgtggagtgccgggcttgtgactgtgaccccagagggatcgag
acaagtcagtgtgaccaatccacaggccagtgtgtttgcattgagggtgtggagggggca
cgctgcgacaagtgcacccgtgggtattcgggcgtcttccctgattgcactccctgccac
cagtgctttgcattgtgggatgtcatcatctctgagctgaccaacaggacccacaaattc
ctggagaaagcaaaggctttgaagatcagtggtgtgattgggccttaccgagagacagtt
gattctgtggaaaggaaagtcaatgaaataaagagtatacttgcccaaagcccagctgca
gagcccctgaagaacattggaaacctctttgaggaggcagagaagctaaccaaagatgtt
acagaaaaaatgtcggaggttgaagtgaagttatctgacacggcctcacaaagtaacaac
acagttggagagctggattccctgcagatggatgcacagagcttggacaaaacagtgaaa
gaacttgctgaacaactggagtttatcaaaaactcagatattcggggagccttggacagt
attaccaaatactttcagatgtctcttgaggcagaggaaagagtgaatgcctccaccatt
gataccaatagcaccgtagaacagtcagcccttactcgaaacaaagttgaagacttaatg
atggaaagagaggcccagttcaaggaaaaacaggaggaacaatcccgccttctagatgag
cttgcgggcagattacagggtttggatctttctgctgtagctgaacagacttgtggaact
cctccgggggccttgtgtgccgaaacgccatgtggggggccaaactgcaggacagatgat
ggggcaaagaagtgtggtggacctggttgtgatggcttagtcaccgtggcccacaacgcc
tggcagaaagccatggacttcgacagagacgtcctcagtgcgctggctgaggtggaacaa
ctctcacagacggtctctgaagctaaactgagggcagatgaagcaaaacaaagcgcccag
gcagttctgttgaaaactaatgccaccaaagaaaaagtggacaagagcaatgaggatctg
aggaatctgatcaagcaaattcgaaactttctgactcaggacagtgctgatctggatagc
attgaggctgttgctaatgaagtactgaagatggagatgccaagcactccccaacagttg
cagaacctaaccgaagatattcgggaacgagtagaaagtctttcccaagtagaagttatt
cttcagcaaagtgctagtgacattgccagagcagaaatgctcttagatgaagcaaagaga
gccagcaaaagtgcaacagatgttaaagtcactgcagatatggtaaaggaagccctggaa
gaagctgaaaaggctcagattgcagcagaaagggcaattaaacaagcagatgaagacatt
caaggaactcaaaacctactgacttcaattgaatccgaaactgcagcatctgaagaaacc
ttatacaatgcctctcagcgcataaatgagctagaaaggaatgtggaagaacttaagagg
aaggctgcccagaacactgaggaggcaggctacatagggcaggtagtggatatcgtaaaa
caaagtgcagatgacgttaagaaggtcctcgacagtgaacttagtggaaagtataaaaaa
gtagaaaacctaattgccaagaaaactgaagagtcagctgatgccagaaagaaagcagaa
atgctacaaaatgaagctaaaatgctgcttgcccaagcaaacagtaagctccaactgcta
aaagatttagagcaaaaatatgaagacaatcaaaaatatctagaagataaagctcaagaa
ctagcaaaactagaagaagaagtccgttcacttctacaggatataagccaaaaagttgct
gtttatagcacttgtttgtaa

KEGG   Phascolarctos cinereus (koala): 110208858
Entry
110208858         CDS       T05867                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2 isoform X1
  KO
K05637  laminin, alpha 1/2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
pcw05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110208858 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110208858 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110208858 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110208858 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110208858 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110208858 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110208858 (LAMA2)
   05414 Dilated cardiomyopathy
    110208858 (LAMA2)
   05416 Viral myocarditis
    110208858 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110208858 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110208858 (LAMA2)
   05145 Toxoplasmosis
    110208858 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_N Laminin_B Laminin_I Laminin_II Laminin_G_3 LXG AAA_13
Other DBs
NCBI-GeneID: 110208858
NCBI-ProteinID: XP_020842683
UniProt: A0A6P5KB29
LinkDB
Position
Unknown
AA seq 3137 aa
MPGHAWHFFLLLFTGLGSPDSIGAQQQQRAPSHLQQTHPQRGLFPAVLNLATNALITTNA
TCGERGPEMYCKLVEHVPGQPVRNPQCRTCNQNSSFAYQRHPITNAIDGKNTWWQSPSIK
NGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDGVEYKPWQYHAITDTEC
LTRYGIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFT
SARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARAC
PLDPSTNKSRCECEHNTCGDSCDQCCPGFHQKPWKAGTFLTKTECEACNCHGKAEECYYD
ENVASRNLSLNIHGKYIGGGVCINCTQNTTGINCETCIDGFFRPKGVSPNFYRPCQPCYC
DPIGSLNEICVKDENHARRGLLPGSCHCRHGFGGVRCARCARGYTGYPDCVHCNCSGLGS
TNEDPCIGPCNCKENVEGRDCSRCKVGFFNLQENNHKGCEECFCSGVSDRCQSSRWTYSN
INDMDGWYLTDVAGLLRVLPHQDNSGQSQQLSINTVDAKRELPRIYYWTAPGPYLGNKVT
AAGGQLKFTISYDLIGEEEDRENVLQFMIILEGNGFRISTAQEEIYLSPSEEYTHVVLLS
SELFNVHGTGSRVSRKEFMTVLANIKRLLIQATYILGMDAIFRLNSVSLESAVPYPTDGD
LADAVELCQCPPGYSGSSCESCWPGHRRVNGTILGGICEPCQCFGHAEACEDITGECVGC
KDHTGGPYCNRCLPGFYGDPTKGTTDDCQPCACPLNIPSNNFSPTCHLDWSRGLICDECP
VGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGH
YCERCADGYFGDAVDAKNCQPCRCNLNGSFSEVCHTKTGQCECRPNVQGLHCDECQPQTF
GIQSSRGCVPCNCNSFGSKSFDCEESGQCWCQPGVAGKKCDRCARGFFNFQEGGCTPCEC
THLGNNCDPNTGQCICPPNTIGDKCDKCAPNSWGHSIIHGCKACNCSLVGSLDFQCNINT
GQCSCYPEFSGTRCTECNLGHWNYPHCNLCDCFLAGTDASTCNSETKKCACLNQSGQCTC
KVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCFGMTNQCTEAKGLIRMWVTLTPEQTILP
LVDEALQHTTTKGIAFQNPEIVANMERVREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYT
IYFEAREETGFSTYNPQVIIRGGTPTRARIITRHMAAPLIGQLTRHEIEMTENEWKYYGD
DPRTSRMVTREDFLDVLYDIHYILIKATYGNIIRQSRISEISMEVAEEGAVSALSPQAHL
IEKCDCPPGYSGFSCEACMPGFYRLPSESGGRIPGPSLGTCVPCQCNGHSDTCDTETSKC
QDCQHHTAGDFCERCAVGYYGTVKGLPNDCRQCACPLITSSNNFSPSCILEGLDDYRCTA
CPRGYEGQYCERCAFGYTGSPSSPGGSCQECECDPYGSLPVPCDPVTGHCTCRPGATGQK
CDGCKAGHARDGMECIFCGDECTGLLLGDLARLEQMAVSINLTGPLPAPYKMLYNFENVT
QELKHLLSPQRAPERLRQLAESNLNTLVTEMDELLTRATKVTADGEQTGQDAERTNMRAK
ILGGIVKEIVQDAEAVNEKAIKLNETLGAQDKALEKSLQELQQEIDQMMAELRQKNLDMQ
NEVAQDELVAAEALLRKVKKLFGESRGKNEELEKELRDKLTDYKSKVDDAQDLLREATDK
IREADRLSETNQNNMTDLEKKRQAVESGKQETEKTLKEGNDILDEANHLADEINSVIDFV
KDMQKKLPATSEELKDKIDDLSQEIKDRRLPEKVLQAEDHAAQLNESSAVLDGILEEAKN
ISFNATAAFKAYSNIKDYIDEAERVAKEAKGHANEATQLASGPQGSLKDDAKGSLQKSFR
VLNEAKRLANDVKENDDNLRGMKNRLENANEKNGDLLKGLNDTLGKLSAIPTDTAAKLQT
VKDKARQANDTAKDVLAQIKDLNQNLAGLRNNYNKLADDVAKTNAVVKDPAKNKIIADAD
ATVKNLEQEADRLIDKLKPIKELQDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIR
TYRPEIKKGSYNSIIVNVKTAVADNLLFYLGSAKFTDFLAIEMRKGKVNFLWDVGSGVGR
VEYPDLTIDDSYWYRIEASRTGRNGTISVRALDGPKASIIPSTYNSISPPGYTILDVDAN
AMLFVGGLTGKLKKADAVRVITFTGCMGETYFDSKPIGLWNFRDIEGDCKGCTVSPQVED
SEGTIQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELTDG
HIKVSYDLGSGIASVISNQNHNDGKWKSFTLSRIQKQANVSIVDIDTNQEENIATTSLGN
NFGLDLKADDKIYFGGLPTLRNLSMKARPEVNLKKYAGCLKDIEISRTPYNILSSPDYVG
VTKGCSLENVYIVSFPKPGFVELPPVPLDVGTEINLSFSTKNDSGIILLGSGGANNSPRR
KRRQTGQAYYAIFLNRGRLEVHLSTGVRTIRKIVVRPELTPFHDGREHSIHVERTRGMFT
VQVDEDRKHMQNLTVEQTITIKKLFVGGSPSPFQPPPLRTIPPFEGCIWNLVINSIPMDF
AQPVSFKNADIGRCIDHKPGEGEVEVTPEQIVFPPDSVLEEDKETTPAFPKFPSPPPTPT
LAHGPCAADTEPALLIGSKQFGLSRNSHIAIAFDDTKVKNSLTIEFEIRTEAESGLMFYM
ARINHADFATVQLKNGMPFFSYDLGSGNTSTMIPTKINDGQWHKIKILRTKQEGILLVDG
ASNRTTSPKKADILDVVGMLYIGGLPINYTTRRIGPVVYSIDGCMKNLQMAEAPADLENP
TSSFSVGTCYVNAEKGTYFDGTGFAKAVGAYKVGLDLLVEFEFRTTRTTGVLLGISSQKM
DGMGIELVDEKLMFHVDNGAGLFTAVYDAGVPGALCDGEWHKVTANKIKHRIELTVDGNQ
VEAQSPNTASTSADTNDPVFVGGYPDGLNQFGLTINIPFRGCIRSLKFTKGTAKALEINF
AKALELKGVQPVSCPAN
NT seq 9414 nt   +upstreamnt  +downstreamnt
atgccggggcacgcctggcactttttcctcctgctgttcacagggctaggcagtcctgac
agcatcggagcccagcaacagcagcgagccccatcccatctgcagcagactcatccgcaa
agaggtttatttccagctgtgctgaatctggccacaaatgcactcatcaccactaatgcg
acatgtggtgaacgaggccctgaaatgtactgcaagttggtagaacacgtccctggacaa
cctgtgaggaacccccagtgtcggacttgcaatcagaacagcagctttgcctaccagagg
cacccaatcacgaatgcaattgatggcaagaacacttggtggcagagccccagtattaag
aatggcattgaataccattatgtgaccattacactggatttgcagcaggtgttccagatt
gcatacgtaattgtgaaagcagcaaactcaccacgacctggaaattggatattggaacgc
tctctagatggtgttgaatacaaaccatggcagtaccatgctatcactgacacagaatgc
ctaacacgctatggcatttatccacgcactgggccaccatcatatgcaaaagacgatgag
gtgatatgtacttcattttattccaagatccacccgctggaaaatggagagatccacata
tctctgatcaatggaaggcctagtgctgatgatccttccccagaacttctcgaattcacc
tcagcacgctatattcgcctgagatttcagaggatccggaccctgaatgcagatttgatg
atgtttgcccacaaagaccccagggaaatcgaccccattgttacaagaagatattactat
tcagtcaaggatatttccgtgggaggaatgtgcatctgctatggtcatgccagagcttgt
ccacttgatccatcaacaaataaatctcgttgtgaatgtgagcacaatacctgtggtgat
agttgtgatcaatgctgtccaggatttcaccaaaaaccttggaaagcagggacttttctg
accaagactgaatgtgaagcatgcaattgtcacggaaaggctgaagaatgctattacgat
gaaaatgttgccagcagaaacctgagcttgaatatccatggaaagtacattggaggtggc
gtatgcattaactgtactcagaacaccacaggcatcaactgcgaaacttgtattgatggc
ttcttcagacccaaaggggtatcaccaaatttttacaggccatgccaaccatgctattgt
gatccaattggatccttaaatgaaatctgtgttaaggatgagaatcatgccagacgaggt
ctattgcctggatcttgccattgcagacatggctttggaggagtcagatgtgctcgatgt
gctcgaggttatactggttaccctgactgtgtgcattgcaattgcagtggcttaggaagc
actaatgaggatccttgtataggaccctgtaactgcaaggaaaatgtcgaaggcagagac
tgcagtcgctgcaaagtgggcttcttcaatttacaagagaataatcacaagggctgtgag
gaatgtttctgctcaggagtgtcagatagatgtcaaagctcccgctggacctatagcaac
ataaatgatatggatggctggtatcttactgatgtagctggtctactgagggttttacct
catcaggacaactctggtcaatcccagcaactcagcatcaataccgtggatgcaaaaaga
gaactaccacgaatctattactggactgcacctggaccatatttaggcaacaaagtgaca
gcagctggaggacaattgaaatttactatttcttatgacctcataggagaggaagaagat
cgagaaaatgtattgcagttcatgatcatcttagagggaaatggttttcgaatcagcaca
gcccaggaagaaatctacctgtcaccatctgaagagtatactcatgttgtgttgctcagt
tcagaattatttaatgtgcatggcactggatctcgagtcagtagaaaggaatttatgacc
gtcctggcaaatataaagagacttctcatacaagccacatacatccttgggatggatgcc
atcttcaggttgaactctgtgagtcttgaatcagctgtgccatatcctactgatggagac
cttgcagatgcagtggagctttgtcagtgccctccagggtatagtggctcctcttgtgag
tcttgttggcctgggcataggagagttaatggcacgattctcggtggcatctgtgaacca
tgtcaatgctttggtcatgcagaggcatgtgaggacatcacaggagaatgtgtgggatgc
aaagaccacacaggtggtccgtattgcaatagatgtcttcctggtttctatggtgatcca
actaaaggaaccactgatgactgtcaaccttgtgcatgcccattaaacataccatctaat
aacttcagtccaacgtgccacttagactggagtcggggattgatatgtgatgaatgccct
gtcgggtacacaggaccacgctgtgagaggtgtgcagaaggctattttggacaaccttct
gtacctggaggatcatgtcagccatgccaatgcaatgacaaccttgacttctccatccca
ggcagctgtgacagcttgtctggctcttgtctgatatgtaagccaggtacaacaggccac
tactgtgagcgctgtgctgatggatattttggagatgcagttgatgcaaagaactgtcag
ccatgtcgctgtaacctcaatggctctttctcagaggtttgccacacaaagacagggcaa
tgtgaatgtagacccaatgttcaaggacttcattgtgatgagtgtcagcctcaaaccttt
ggcatacagtcctcccggggctgtgttccctgtaactgcaattcctttggatccaagtct
tttgattgtgaagagagtgggcagtgctggtgccagcctggagtagcaggaaagaaatgt
gaccgatgtgctcgtggctttttcaactttcaagagggaggttgcactccctgtgagtgt
acccatctaggtaataactgtgacccaaatactggccaatgtatttgtcctcccaatacc
attggagacaagtgtgataagtgtgcaccgaattcttggggccacagcatcatccatggc
tgtaaggcttgtaattgcagtttggtgggatcacttgatttccagtgtaatataaacact
ggccaatgctcctgctacccagaattctctggtacaagatgtacagaatgcaatttgggc
cactggaattatcctcattgcaatttgtgtgactgcttcctggctgggaccgatgcatca
acctgcaactcagaaacgaaaaaatgtgcatgccttaatcaaagtggacaatgtacttgt
aaggtaaatgttgaaggtgtccactgtgacaggtgccgtcctggcaaatttggacttgat
gccaagaacccacttggctgcagcagctgctattgctttggcatgactaaccagtgcact
gaagcaaagggactgatccgtatgtgggtaacactgacacctgaacagaccatccttcca
ctggtggatgaagccctccaacacacaaccaccaaaggaattgcttttcagaacccagag
attgttgcaaacatggaacgggtgagagaggatctccatctggaacctttttattggaaa
cttccagaacaatttgaagggaagaagttgatggcctacggtggcaagctgaagtataca
atctactttgaagctcgtgaagaaacaggattttctacctataacccacaagttataatt
cgaggtggaactccaactcgtgctagaattatcacccggcatatggcagctcctctaatt
ggacaactgacaaggcatgaaatagaaatgacagagaatgaatggaaatattacggtgat
gacccccgcacaagtaggatggtgacacgggaggacttcttggatgtactctatgacatt
cattacattcttatcaaggctacttatgggaatatcattcggcaaagcagaatttctgag
atctcaatggaagtagctgaagaaggagctgtatcagcattaagtccacaagctcacttg
attgaaaaatgtgactgtcccccaggttattctggcttctcctgtgaggcctgcatgcca
ggattttatagattgccttctgaatctggtggccgaatacctggaccaagcctgggcact
tgtgttccatgtcagtgtaatggacatagtgatacatgtgacactgaaacctccaaatgt
caggactgtcaacatcatactgctggtgacttctgtgaaagatgtgctgttgggtactat
ggaactgtcaagggactgcccaatgattgtcggcaatgtgcctgtccgctcatcacttct
agcaacaattttagcccttcttgcatcttagaaggacttgatgactatcgatgtacagct
tgcccacgtggatatgaaggccagtactgtgaaaggtgtgcctttggctacactggcagc
ccaagcagcccaggaggctcctgccaagaatgtgagtgtgatccatatggctcgcttcct
gtcccctgtgacccagtcaccggacattgtacttgccgacctggagccaccgggcagaag
tgtgatggctgcaaggccgggcatgcgcgtgatggcatggagtgtattttttgtggtgat
gaatgtacaggactccttctcggtgacttggctcgccttgagcagatggctgttagcatc
aaccttactggcccactgcccgcaccatataaaatgctatacaattttgaaaatgtgact
caggagctaaagcacttgttgtcacctcagcgggcaccagagagacttcgtcaactggca
gagagtaatctgaatacactggtgaccgaaatggatgaacttctcactagagctaccaag
gtgacagcagatggcgagcagactgggcaggatgctgagcgaaccaacatgagagcaaag
attctgggaggaatcgttaaggaaattgtccaggatgcagaagctgtaaatgaaaaagct
ataaaactaaatgaaactcttggagcccaggacaaagctttggagaaaagtcttcaagag
ctacagcaagagatcgatcagatgatggcagaattaaggcagaaaaatctagatatgcaa
aatgaagttgcccaggatgagttggtagctgctgaagcccttctgaggaaagtaaagaag
ttatttggagaatctcgggggaaaaacgaagagttggaaaaagagctcagggacaaactg
actgattacaaaagcaaagtagatgatgcccaggacctgttgagagaagccaccgataaa
atcagagaggctgatcgcttatctgaaacaaaccaaaataacatgacggatttggagaaa
aagagacaagctgttgaaagtgggaaacaagaaactgagaaaacattaaaagagggcaat
gacatacttgatgaagccaaccatcttgctgatgaaatcaactctgtgatagattttgtt
aaggacatgcagaaaaagttgccagcaacatctgaggaacttaaggacaaaatagatgat
ctgtcccaagaaattaaagatagaagacttccagagaaggtgttacaggctgaagaccat
gcagctcagctgaatgaatcatctgcagtgctagatggaatcctcgaagaagctaaaaac
atctccttcaatgctactgcagccttcaaagcttacagcaacatcaaagactacattgat
gaagctgaaagggttgccaaggaagccaaaggtcatgcgaacgaagccacacaactggca
tctggtcctcaaggttcattaaaggatgatgccaagggttctcttcagaagagcttcaga
gttctaaatgaagctaagaggctagcaaatgatgttaaagaaaatgatgataatctaaga
ggcatgaaaaacagattggaaaatgctaatgaaaagaatggtgacctcctaaaaggtttg
aatgacacactgggaaagttatcagccattccaactgatacagctgcaaagttgcaaact
gttaaagacaaagcaagacaagccaatgatacagcaaaagatgtcctggcacagattaaa
gatctcaaccagaaccttgcaggcctgaggaacaattacaataaactggcagatgatgta
gccaagacaaatgctgtggtgaaagaccctgccaagaacaaaatcattgcagatgcagat
gccaccgttaaaaatcttgagcaagaagctgatcggttgatagacaaactcaagccaatc
aaggagcttcaggataacctgaaaaaaaatatctctgagataaaggaactgataaaccaa
gcccggaaacaagccaattcgatcaaagtctctgtgtcttctggaggtgactgcattaga
acatacaggccagaaatcaagaaaggaagctacaatagcatcattgtcaacgtgaagaca
gctgttgcagataatctccttttttatcttggcagtgccaagtttactgattttctggcc
atagaaatgagaaaggggaaagtgaacttcctctgggatgtcggctctggagttggacga
gttgaatacccagatttgaccattgatgactcctactggtaccgaattgaagcatcaaga
actgggaggaatggaactatttctgttagagcactggatggtcccaaagccagcatcata
ccaagcacatacaattcaatctctcccccgggctatacaattctagatgtggatgcaaat
gcaatgctctttgttggtggcttaactgggaaattaaagaaggctgatgctgtacgagtc
attaccttcactggatgtatgggtgaaacatactttgacagcaaacccatagggttgtgg
aatttccgagatatagaaggtgactgtaaaggatgcacagtcagtccacaggtagaagac
agtgagggtacaattcagtttgatggagaaggctatgctttagtcagccgccccatacgc
tggtaccccaatatctctacagtcatgttcaagttcaggaccttttcctcaagtgctctc
ctgatgtaccttgccacccgagatctgaaagattttatgagtgtagaactcactgatgga
cacataaaagtcagctatgatctgggttcaggcattgcttctgttatcagcaaccaaaac
cataatgatggaaaatggaaatccttcaccctgtcaagaattcaaaaacaagccaacgtc
tctattgtagacatcgatactaaccaggaggaaaacatagcaacaacatctttgggaaat
aattttggccttgacttgaaagcagatgacaagatatattttggtggtttgccaaccctg
agaaacctgagtatgaaagccaggcctgaagtaaacttgaagaaatatgctggatgcctc
aaggatattgaaatttcgcgaacaccatataatatactcagtagtcccgactatgttggt
gtgaccaaaggatgttcacttgagaatgtttacattgttagttttcccaagcctggattt
gtagagcttccaccagtgccactggatgttggcacagaaatcaacctctccttcagcacc
aaaaatgattctgggatcattcttctaggaagtggtggagctaataactcaccaaggaga
aaacgaagacaaactggacaggcctactatgctatattcctgaacagaggccgcctggaa
gtacatctctctaccggcgtgaggaccatacgcaagatcgtggtcaggccagagctaacc
ccatttcacgatgggagagaacattccattcatgtggaaagaacaagaggtatgtttact
gtccaagtggatgaagacagaaaacatatgcagaacctgacagtggaacagactattacc
attaaaaaactctttgtaggaggctctccatctccatttcaacctcccccactcagaact
atacctccttttgaaggctgtatatggaaccttgttattaactccatcccgatggacttt
gctcaacctgtgtccttcaaaaatgcagacattggtcgctgcatagatcacaaacctggt
gaaggagaggttgaagttactccagaacaaattgttttcccgcctgattctgtccttgaa
gaggataaagagaccacaccagcctttccgaaattcccctctccaccacctacacctact
cttgctcatggaccctgtgctgcagatacagaaccagctcttttgataggaagcaagcag
tttggactttcaagaaacagccatattgcaattgcttttgatgacaccaaagttaaaaac
agcctcacaattgaatttgaaatacgaactgaagctgaatcaggcttgatgttttacatg
gctcggatcaaccatgccgattttgctacagtgcaactgaagaatggcatgcccttcttc
agctatgatctcgggagcggtaacacaagtaccatgatccccaccaaaatcaacgatggt
cagtggcacaagattaagatcctccggaccaagcaagaaggaatcttacttgtagatggt
gcttctaacaggacaaccagccccaagaaagctgatatcctggatgttgtgggaatgctg
tacattggagggctgcccatcaactacacaacaagaagaattggtccagtcgtctacagc
atcgatggctgcatgaagaatcttcaaatggcagaggctcctgcagaccttgaaaatcca
acctccagcttcagtgttggcacgtgttatgtaaacgctgaaaaaggaacgtattttgat
ggaacaggttttgccaaagcagttggagcctacaaagtaggattggaccttcttgtggaa
tttgaattccgtaccactagaaccactggtgttcttctgggaatcagcagccaaaaaatg
gatggcatgggcatcgaactggtagatgaaaaactcatgtttcatgtggataatggtgca
ggcctgttcactgctgtttatgacgccggtgtccctggagctttgtgtgatggggagtgg
cataaggtgactgcaaacaaaatcaaacaccgaatagagttaacagtggatgggaaccaa
gtggaagctcagagtccaaacactgcgtctacatcagctgatacaaatgatcctgtcttt
gttggaggatatccagatggtctcaatcagtttggcctcacaatcaatatcccattcaga
ggatgcatccgctcactgaaattcaccaaaggcactgccaaagctctggaaattaacttt
gcaaaagccttggagctgaagggtgtccagcctgtatcttgcccagccaactaa

KEGG   Phascolarctos cinereus (koala): 110216959
Entry
110216959         CDS       T05867                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit beta-2-like
  KO
K06243  laminin, beta 2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110216959
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110216959
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110216959
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110216959
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110216959
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110216959
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110216959
   05145 Toxoplasmosis
    110216959
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Crescentin Laminin_II F5_F8_type_C LpxB DUF4951 BST2
Other DBs
NCBI-GeneID: 110216959
NCBI-ProteinID: XP_020854705
UniProt: A0A6P5L8Y3
LinkDB
Position
Unknown
AA seq 1838 aa
MPSRGVGSLSHLYWITPAPHFSATSQVGYCFIVLLLLIQIPHACAHEVPDLLPRPGCSGG
SCYPPTGNLVVGRSQSLHASSTCGLKGPEPYCIVSHLQDSEKCFFCDSRGQGGHRIKNVI
SLSGPDGQRTWWQAESGVENVSIQLDLEGEFYFTHLIMTFKTFRPAGLLIERSADGGRSW
RVYRYFAHNCSGLFPGVPLTPGRKVSDLVCDQRYSNIEPSSQGEVIFKVLDPAIPVENPY
SPEIQELLRVTNLRVNFSKLHTLGDGPLGGWGHHHGPYYYYALYELVVRGSCLCHGHASE
CAPAPGAPPSVDGMVHGLCVCQHQTAGPHCEHCQDLHHDQPWHPAEPGNPHACQECECHQ
HARSCHFDIAVFVASGNVSGGVCDACQHHTAGRHCEICRPFYYRDPREDPRSPYTCKPCD
CDPSGTLDGGLCDTHTDEVQGLLSGQCRCKAHVWGPRCDTCRPGYYGLSPALPEGCLSCR
CXSSGTVRGDTPCDSINGDCYCKRFVTGQNCDQCLPEFWGLSSDFTGCRPCDCDFGGAYS
NRCSSGEGLCPCRPHLQGRDCLELQSGYFCAALDQAVAEVELGQRLKPSDPRLPGAPLSD
VPRNCLPTTGPVPKRLRPRLWRQRSTPCPVQVTRHGRHSHHPSEAAVEPRPGGQGPQTYS
WTGPGFARVEDRAGLMFQAPPVPRAMEYDIVLRYKAQAPEDWEALVSVRASSLPSSTRCA
NVLPSEQLYQVALPSRRRAVVLSRPFCFEPGTRYMVTLRLQRVTSTRSLPRGSILLDSLV
LLPRVEELPGLRRGDPGASSRLRELSRAQCLEAARTPPLGPPSESCARLICSISALLYGG
GLACECDPQGSLSSECARVGGQCPCRPHVIGQRCDQCEPQTYGFGPAGCSECHCSPEGST
SLACDPLSGQCPCQLGITGRRCDQCLPGQWGFPRCQPCECNGHAKQCHPHTGVCRACGDA
TTGRHCERCQDGYYGDPVLGSGQQCRPCPCPGFLGSGNYHGTSCQADGGSERILCLCAPG
YAGPRCDRCSAGYFGRPWPEGVVGRSPCRPCQCNNNIDPSDPMACDPHSGHCQRCLHHTH
GPHCSHCQPGYYGNALWPRGCRRCSCDLQGTVPARCLPESGICFCDRLSGHCPCRPHVLG
QFCDRCAPQFWNLRGPRGCEPCACHTQHSVQLTCHPVTGQCPCREGFGGRTCSQCQEGYW
GAPEKECKACACDPQGSVSLRCHPRTGACSCLDGISGPQCKACARGSQGSFPHCRPCPTC
FSQWDGQLDALQQRLATLAQGRDALSEVAPDRGNGGRLLALEAAIGQVQGVLVSTRPLVG
PLQQLMQHRDILRREVSVLGRALRGAERSVGVSGPWAGAQHSRIGQLAQEVEHLKHLTVQ
LKEAPGGAGGDAASLVSRAALISQEAEFGVRVTTALMDTESALSQSHNVRSRTEGLLREM
KPPFRAPAWREQLQGLVNASWALSPSLAQLKVCGGPWGVGRACALSPCGPASCPGALPAS
LRALGTARNTSHALGTTGTRLGRLHRRLQRIGTMARAAHLQAEETLSRARVTWRGAGTAP
ILATIQRIRAFLTNEGADPESVELVAQRVLKIPLPQGGQRAIEQLLEEIQAALQLPDSMD
WALPSAQGLLQQVQWTREDADRTQDNVGKTRGALAEAQNNIGRAERELRKTKQALRSLEV
QTQEMALGLAQATRDLDVGATLDQLLGAADALQAQMSENKLQLREAQEQAEQASDTAANL
GKELQTAKLQFSELQSGIDGLGVEVNGARDRLQQIQAEARELLKKANRSRSRLEGLEKRF
AGNEQALGEKAAELGALEIRALGLLEQLRQEASAHSTC
NT seq 5517 nt   +upstreamnt  +downstreamnt
atgcccagcaggggagtgggtagcctgagccatctgtactggataacccctgctccccat
ttctcagccacaagccaagtgggatactgtttcatcgtgctgctgctgctaatacagata
ccccatgcctgtgcccatgaagtacctgaccttctgccccgacctggctgctctggaggg
agctgttaccctcccactggcaatctggttgtgggcaggagccagagtctccacgcctcg
tccacctgtggtttgaaggggcctgagccctactgcattgtcagccacttacaggactct
gagaaatgcttcttttgtgactcaaggggccagggaggccataggatcaagaatgtgatc
tccctgagcggacccgatgggcaaagaacatggtggcaggctgagagtggtgtggagaat
gtcagtatccagctggacttggagggtgaattctacttcacccatcttatcatgaccttc
aagacttttcgcccagctggtctactcattgagcgttcagcagatgggggtcgatcctgg
cgagtttaccgatactttgctcacaactgctctggcctcttccctggggttccccttaca
cctggtcgcaaagtcagcgacctcgtttgtgatcagcgttactcgaacattgaaccatca
agccagggtgaggtaattttcaaagttctggacccagccatccctgtggagaatccctat
agtccagagatccaagaacttcttcgagttaccaacctgagagtgaatttctctaaactc
cacacattgggagatgggcccctggggggctggggccaccaccatgggccttactactac
tatgccttgtacgagcttgtggtccgaggaagttgcctttgccatggacatgcctctgag
tgtgcacctgctcctggtgccccacctagtgtggatggcatggtccacgggctttgtgtg
tgtcagcaccagacagctggaccccactgtgagcactgccaggacctgcaccatgaccaa
ccctggcacccagctgagcctgggaatcctcacgcctgccaggagtgtgaatgccatcag
catgccaggagttgccactttgacatagctgtttttgtggcctcaggcaatgtgagtgga
ggtgtgtgtgatgcatgtcagcaccacacagcagggaggcactgtgagatctgccgaccc
ttctactacagggacccccgtgaagacccccgctccccatatacctgtaaaccttgtgac
tgtgacccttcaggcaccctggatgggggtctctgtgacacacacacagatgaggtccag
gggctcctctctggacagtgtcgctgcaaagcccacgtgtggggcccacgctgtgatacc
tgtcgtcctggttactatggtctgagcccagcattacctgaaggttgtttgtcctgcagg
tgtngatcctcgggtacagtccgaggtgacaccccctgtgactccatcaatggtgactgc
tattgcaaacgttttgttactggccagaactgtgaccaatgcctgccggaattctggggc
ctgagcagtgacttcactggctgccggccttgtgattgtgattttggtggcgcctacagc
aacaggtgctcgtcaggggaggggctttgtccttgtcgcccccacctacaaggccgagac
tgccttgagctccagtctggttatttctgtgcagccctggaccaggctgtagctgaggtg
gagcttgggcagagactcaagccctctgacccccggctacctggagcccctctatctgat
gtcccccgcaactgcctgccaacaacaggacctgtgccgaagaggctcagaccccggctc
tggcgccagcgtagcacgccctgccctgtgcaggttactcgccatggacgccacagccat
catccatcagaggctgctgtggagccgcggcctgggggccagggccctcagacctactcc
tggacaggccctgggtttgccagggtggaggacagggctggcctcatgttccaggcccct
ccagtgccacgagccatggaatatgacattgtgctgcgttataaagctcaggcccccgag
gactgggaggcccttgtcagtgtccgtgccagctccctgcccagcagcacccgttgtgcc
aatgtgttgccctcagagcagctctatcaggtggccctaccttccaggcgcagagctgtg
gttctgtctagacccttctgctttgaacctggaaccagatacatggtgaccttgagactg
cagcgagtgacaagtacacggagcctacccaggggaagcatcttgctagactccctggtg
cttctgcctcgagtagaagaacttccaggcctaagaaggggggaccctggggcatcgagt
cgcctgagagaactcagtcgtgcccagtgccttgaagctgcaagaacaccccccctaggg
ccaccatcagagtcctgtgcccgcttgatctgtagcatctctgcccttctctatggtggt
ggcctggcctgtgagtgtgacccacagggctctctgagctccgagtgtgcccgtgtgggt
ggccagtgcccatgtcgaccccacgtcattggccagcgctgtgaccagtgtgagccccag
acatatggctttggcccagcaggctgcagtgagtgtcattgttcccctgaggggtccacc
agtttggcctgtgatcctttaagtggacagtgcccatgccagctaggcatcacaggacga
aggtgtgaccagtgcctgcctggccagtggggctttcctcggtgccagccctgtgagtgt
aatgggcatgcaaagcagtgccacccacacacaggtgtgtgccgggcctgtggagatgcc
accactgggcgtcattgtgaaaggtgccaggatggttattatggagaccctgtcctgggc
tctggacagcagtgccggccttgtccctgccctgggttcctgggctctggtaattaccat
gggacctcatgtcaagcggatggtgggagtgaacgaatcctgtgtctctgtgcccctggt
tatgcaggtcctcgctgtgaccgctgctctgctggctactttgggcgcccctggccagag
ggagtagtggggaggtcaccttgccgaccctgccagtgcaacaacaacatcgaccctagc
gaccccatggcctgtgacccccacagtgggcactgccagcgctgtctacaccacacccat
gggccacactgttcacactgccagcctggctactacggcaatgccctctggccacgaggc
tgccggcgttgcagctgtgacctacaaggcacagtgcctgcccggtgcctgcctgaaagt
ggcatctgtttctgtgataggctcagtgggcactgcccctgccgcccacatgtcctaggg
cagttctgtgatcgctgtgccccccagttctggaatctgcgagggcctcggggctgtgag
ccctgtgcttgtcatacccagcactcagtgcagctaacctgtcatccggtcactggtcag
tgcccatgccgggaaggatttgggggacgtacctgctctcagtgccaagaagggtactgg
ggggccccagagaaggagtgtaaagcttgtgcctgtgaccctcagggctcagtctctctg
cgttgccaccctaggacaggggcctgctcgtgtctcgatggcatctcaggccctcagtgc
aaggcctgtgcccggggctcccagggcagtttcccccactgccgtccctgcccaacctgc
ttctctcaatgggatggacaactggatgccctccagcagcggctggccactttggctcag
gggagggatgccctgagtgaggtggctcctgataggggcaatgggggacggctgctggcc
ctggaagcagccatagggcaggtccagggagtcctggtgtccacccgtcccctggtgggg
cccttgcagcaactcatgcaacatcgggatatactcaggagggaggtgtcagtgctgggc
cgagcacttcgaggggcggagcggagtgtgggtgtgagtggtccctgggctggagctcag
cactcccgcataggccagctggcacaagaagtagaacatctcaaacacttgacggtccag
ctcaaggaggccccaggaggagccgggggggatgctgcttccctggtctccagggctgct
ttgatctcccaggaggctgagtttggtgttagagtcacgactgccctgatggacacagag
agtgccctgagccaatcccacaatgtccgaagcagaacagaagggctgctgcgagagatg
aagcctcccttcagagctcctgcctggagggagcagctccagggacttgtgaatgcctcc
tgggccctgagccccagcttggcccagctcaaggtctgtggggggccatggggtgtaggg
agggcctgtgctctctccccttgtgggccagcttcttgtcctggggcactgcctgcttcc
ttgagggcactggggactgctcgaaacacatcccatgctttgggtacaacaggtaccaga
ctgggacggctacaccgccggctgcaacgcattgggaccatggcaagggctgcccacttg
caggctgaggagacactgagtagagctcgagtcacatggcgtggggctggcactgctcct
atcttggccaccatccagaggatccgggccttccttacaaatgaaggagcagaccctgag
agcgtggagctggtggcccagagagtcctgaaaatccctctgccccaggggggccagaga
gccatagaacagctgctagaggagatccaagctgccctccagctcccagacagtatggac
tgggctctgccttcagcccagggcctccttcagcaagtacagtggaccagggaggatgca
gacagaactcaggacaatgttgggaagacccggggagctctagctgaggcccagaacaat
atagggagagcagagagagagcttcgaaaaacaaagcaggcactgaggagcctagaagtt
cagacacaggagatggctttagggctagctcaagccacacgtgatctggatgtgggtgcc
accctggaccagctcctgggggcagcagatgctctgcaggcccaaatgtcagaaaacaaa
ctacagctgagggaggcccaggagcaagcagaacaggcatcggacacagctgcaaatttg
ggcaaggagctgcagacagccaaactacagttctcagagcttcagtctgggattgatggt
cttggggttgaggtgaatggggccagagaccgtttgcagcaaattcaggcagaagccaga
gagctgctgaagaaagcaaacaggagtcggagccgcctagaggggctggagaaacgcttt
gccggaaatgagcaggcacttggagagaaggcagctgagcttggggccctggagatcaga
gccttggggctgctggagcagctgaggcaggaagccagtgcccattctacctgctga

KEGG   Phascolarctos cinereus (koala): 110216962
Entry
110216962         CDS       T05867                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2
  KO
K06243  laminin, beta 2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110216962 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110216962 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110216962 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110216962 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110216962 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110216962 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110216962 (LAMB2)
   05145 Toxoplasmosis
    110216962 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C Vps53_N
Other DBs
NCBI-GeneID: 110216962
NCBI-ProteinID: XP_020854712
UniProt: A0A6P5L9S8
LinkDB
Position
Unknown
AA seq 1795 aa
MRLILGYQGWGPRGLELWLLLVLIVLAKAVVQNPDLPSAGCSRGSCYPATGDLLVGRADR
LTASSTCGLRGPEPYCIVSHLQDEKKCFLCDSQHPFSARHPQSHRIQNVVTSFAPQRRSA
WWQSENGVSTVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSSDFGRTWRVYRYFSYDC
GSDFPGIPLAPPHRVDDVVCESRYSEIEPSTEGEVIYRVLDPAIPITDPYSSRIQDLLKI
TNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCARAPGAPAHA
EGMVHGACVCKHNTKGLNCESCQDFYHDLPWRPAEDGHSHACKKCECHQHSRTCHFDMAV
FLASGNVSGGVCDNCQHHTAGMHCEICRPFYYRDPARDLRDPAVCRPCDCDPAGAQDGGL
CDPHDDPALGLVSGQCRCKEHVVGPRCQRCRDGYFGLSITDPQGCQRCQCDPRGTVPGGA
PCDSNSGDCFCKRLVTGRHCDRCLPDHWGLSHDLLGCRPCDCDVGGALEPRCAEDSGQCR
CRRHMFGRRCDQVQPGYFLPFLDHLTFEAEATRGQALEVVERIAHPGMAVSWTGVVFVRL
REGQALEFLVDTVSQAMDYELLLRYEPQVPEQWAEVTLTVQRPGPISPSSPCGTTVPEDD
HFRGMLQPGARYVVLPYPVCLEPGVSYTIRLELMRAGGDARPGAPTPSLLLDSLVLLPRW
SSLEMFSAGDASALERRATFERYRCHEEGLMPAKGPPPEACTPLLRSLAALLYNGALACQ
CDPQGSLSSECQPHGGQCPCKANVAGRRCDHCAPGTFGFGPSGCRACQCSPEGSLSSLCH
EGSGQCPCRPGAFGPRCDRCQPGQWGFPSCRPCHCNGHADECNPQTGSCQGCRDHTAGDR
CERCMAGFYGNPVLASGGHCRPCPCPEGPGGQRHFATSCHQDRHSQQVICHCQPGYTGPR
CEECASGHFGDPLRPGGRCQPCECSNNIDPMDPEACDRRTGQCLRCLHNSEGPRCALCRP
GYYGQAAHQSCRRCTCNFLGTERSQCPSQDKCRCDPGSGQCPCLPNIQGQSCDRCAPNFW
NLASGRGCQPCSCHPSHATSPSCNEFTGQCHCRAGFGGRTCTECQENHWGDPGLQCRACD
CDSRGIETPQCHHATGHCVCRPGVAGVRCDQCARGFSGAFPACQPCHACFGDWDRIVQGL
ASRTRALEQRARELHQLGALGAFEKNFRLLGEKLGTVQGIVNTRNSTAAATLQLMSTTEE
LRRDIEEATGQLTKLEGELTDAQDENFNANHALSGLERDGRALNLTLRQLGQHLDVLKHS
NFLGQGYDSIRQSHAQSSEAEHRANRSALDVPGPVSDSAGTRRQAEGLMGSQRDSFDRRN
VANRRALGELAARANSLSLMRINELVCGAPGDAPCATSPCGGAGCRDEDGQRRCGGLNCQ
GAAATADNALGRARHTQEELRRTLGDADGLVGKVAEARLLAGMARQRAQAALEKANETRD
RVERANQELRELIQNVKDFLSQEGADPGSIEAVATHVLELSIPASPAQIHHLAGEIAERV
RSLGDVDTILQRTAGDVRQAEQLLQEAQRARTRAQGEKQKAEMVQDALEEARRAQGVARG
AIRGAAADTEGTEQTLGRVREKTAEAEQDLSMAAERTQRLDAQLDALKLKRAGNSLEATR
AEETANSAQGRAQEAEKLLKGQLGDRYQTVRDLADRKAQGVLQAKERAERLRDEARGLLQ
DAQDKLRRLHELEGTYEVNERALEGKAAQLDGLEAKMKDVLQSINQQIQIYNTCQ
NT seq 5388 nt   +upstreamnt  +downstreamnt
atgagactgatcttagggtatcaagggtggggcccaaggggactggagctgtggctgctg
ctggtgctaatcgtgctggccaaggctgtggtccagaaccctgacctgccttcagctggc
tgttccaggggaagctgctacccagccaccggagacctcttggttggccgagcagaccga
ctgacagcctcatccacctgcggtctgagaggtcctgagccgtattgcatagtcagtcac
ctacaggatgagaaaaagtgtttcctgtgtgactctcagcatccgttctctgcccgccac
cctcaaagccaccgaatccagaatgtggtcaccagctttgccccacaacgacggtcagcc
tggtggcaatcagaaaatggagtgtccactgtcactatccagctggacttagaggctgaa
tttcactttacccaccttattatgactttcaagacgttccgcccagctgcaatgctggtt
gaacgctcctcagactttgggaggacctggcgtgtctatcgctacttttcctatgactgt
ggctctgacttccctgggatccctctggccccacctcatcgagtggacgatgtggtctgt
gagtctcgctactcggaaattgagccatccactgagggggaggtcatctaccgtgttctg
gacccagccatcccaatcacagatccctatagttcccggatccaggacctactgaagatc
acaaaccttcgggtgaacctgacacggctgcacactctgggcgacaacctgctggacccc
cggagggagatccgagaaaaatattattacgctctctacgagctggtggttcgtgggaac
tgcttctgctatggtcatgcctcccagtgtgctcgggctcctggtgctccagcccatgct
gagggcatggtacatggtgcctgtgtttgcaaacacaacacaaaggggctgaactgtgaa
agctgccaggatttctaccatgacctgccctggcgcccagctgaggatggccattcccat
gcttgtaaaaagtgtgagtgtcaccaacactcccggacctgccactttgacatggctgtg
tttctggcctctggcaacgtgagcggaggtgtgtgtgacaattgccagcaccacacagct
gggatgcactgtgaaatctgccggcctttctactatagagaccccgcgagggatttgcgg
gacccggctgtatgccgcccctgtgattgcgaccctgcgggggcccaggatggtggcctt
tgtgaccctcacgatgaccctgccctggggcttgtctctggtcagtgtcgttgcaaagaa
catgtggtgggccccaggtgtcagcgctgcagagatggctactttgggctcagcatcact
gacccccagggctgccagaggtgccagtgtgacccccggggtacagtgccagggggtgcc
ccttgtgactctaacagtggggactgtttctgcaaacgcctggtgactggaaggcattgt
gaccgatgcttgccggaccactggggtctcagccatgatttacttggttgccgcccatgt
gactgtgatgtaggaggtgccctggaaccccggtgtgccgaggactcgggtcagtgtcga
tgtcgtcgacacatgtttgggcgacgctgtgaccaggtgcagcctggatacttcttgcca
ttcctggaccatctcacctttgaggctgaggccacccgtgggcaggccctggaagtggtg
gagcgaatagcacaccctgggatggcagtctcctggacaggcgtggtctttgtgcgcctg
cgggagggtcaagccctcgagtttttggtggacacagtatcccaggccatggactacgaa
ctgctcctacgatatgaaccccaggtcccagagcagtgggcagaggtgactctgactgtg
cagcgcccagggcctatatctcccagcagcccctgtggcaccactgtgcctgaggatgac
cactttcgggggatgctgcaacctggtgccagatatgtggtattaccctatcctgtctgt
ctggagcccggcgtctcctacactattcgcctggagttgatgcgggctggaggggatgcc
cgtcctggagctcctactcccagcctgctccttgactccctggtgctcttgccccggtgg
tcatccctggagatgtttagcgcaggtgatgccagtgccttggagcgacgggcaactttt
gaacgttaccgctgccatgaggagggcctgatgcccgccaagggccccccgccagaggcc
tgtactcctctcctccgcagtctggctgcattgctctacaatggggccctagcctgccag
tgtgacccccagggctccctaagctccgagtgccagccccatggtggacagtgtccatgc
aaggccaacgtggctgggagacgctgtgaccactgtgctccaggaacctttggctttggc
ccttcaggctgcagggcctgccagtgcagccctgaaggcagcctcagcagtctgtgtcac
gagggcagtgggcagtgcccctgccggcctggagcttttgggccacgctgtgatcggtgc
cagcctggacagtggggcttccccagctgccgcccctgtcactgtaatgggcatgcagat
gagtgcaatccacagactgggtcctgccagggctgccgggaccacacagcaggggaccgc
tgcgaaaggtgtatggctggcttctatgggaacccagtgctggcatccggtggccactgc
cggccttgcccttgtcctgagggcccaggggggcagcgacactttgctacctcctgccat
caggacaggcactcccagcaagtgatttgccactgccagcctggttacactggcccacgc
tgtgaggagtgtgcctctggacactttggggacccactgaggccagggggccggtgccag
ccatgtgaatgcagcaacaacattgaccccatggaccctgaggcctgcgaccgtcgaact
ggacagtgtttgcgctgtctacacaactctgaagggcctcgctgtgccctctgccgccct
ggatactacgggcaggctgcccaccagagctgccggaggtgcacctgtaactttctgggc
acagagcgcagtcagtgcccctctcaagacaaatgccgctgtgatccaggcagtgggcag
tgcccatgcctgcccaatattcagggacagagctgtgaccgttgtgcccccaatttctgg
aacctggccagcgggcgaggctgccagccctgctcctgccaccccagccatgctaccagt
ccctcctgcaatgagttcacagggcagtgtcattgccgagcaggctttggaggtcgcacg
tgcaccgagtgccaggagaatcactggggagatcctggcttgcagtgtcgggcctgtgac
tgtgactcaagaggcattgagacccctcagtgccaccatgccacaggacactgtgtctgc
cggccaggcgtggcaggcgttcgctgtgaccagtgtgcccgaggcttttctggcgctttc
cctgcatgccagccctgccacgcctgctttggggactgggaccggattgtgcaaggcctg
gcctctcgcactcgggcacttgaacagcgagctcgggaattgcaccagctgggggccctg
ggggcctttgagaagaacttccgcctcctgggagagaagctgggcactgtgcagggcatt
gtgaacacccgcaattccacggcggctgccacattgcagcttatgtctactacggaggag
ctgaggcgtgatattgaggaagctacaggacagttgactaagctggagggagagctgaca
gatgcccaggatgagaatttcaatgccaaccacgccctgagtggattggagcgggatggc
cgagctcttaaccttacgctgaggcagctgggacagcatctggatgtgctgaagcactcc
aacttcctgggtcagggctatgatagtatccgtcagtcccacgcccaatcatctgaggcc
gaacatcgtgcaaaccgctcggccctggacgtacctggtcctgtgagtgactcagcaggt
acacggcgccaagcagagggcttgatgggcagccagagagacagcttcgaccggaggaat
gtggccaaccggagggctctaggtgaacttgcagccagggccaacagcctcagcctgatg
cgcatcaatgagctggtatgcggggcccctggggacgctccctgcgccacaagcccatgt
ggcggggctggctgcagggatgaggatggacagcgccgctgcgggggcctgaactgccag
ggagcagcagccacagcagacaacgcactgggccgggcccgtcacacacaggaggaattg
cgccggaccctgggagatgcagatgggctcgtgggcaaggtggcagaggcaaggctacta
gcaggtatggcccggcagcgggcccaggcggccctggaaaaggccaatgagacgcgggac
cgagtggaaagggcaaatcaggaacttcgtgagctgattcaaaatgtcaaggacttcttg
agccaagagggagctgaccctggcagcattgaggcagtagccactcatgtgctagagctg
tccatcccagcatcacctgctcagatccaccatctggcaggtgagattgctgagcgagtt
cggagcctgggggatgtggacactatcctgcagcgtacagcgggggatgtgcgccaggct
gagcagcttctgcaggaagcccagcgggcccggacccgggcccagggtgagaaacagaaa
gccgagatggtgcaggatgcccttgaggaagcacgacgggcgcagggtgtagccagaggc
gccatccgtggggcagccgctgacacagagggcactgagcagacgctgggcagggttcgg
gagaagacagctgaagcagagcaggacctgagcatggcagcagagaggacccagcggctg
gatgctcagctggatgctttgaagttgaagagggctgggaacagcctggaagccacacga
gctgaagagacagctaacagtgcccagggtcgggcccaggaggctgagaagctgctgaag
ggtcagctcggtgaccgataccagacagtgagggatcttgctgatcggaaggcccagggt
gtccttcaggctaaggagagggctgagcggctacgggatgaggcccggggactgctacag
gatgctcaagacaaactccggaggttgcatgagttggagggcacatatgaagtgaatgag
cgggccctggagggcaaagcagcccagttggacggcctggaggccaagatgaaggatgtc
cttcagtccatcaaccagcagattcagatctacaacacctgtcagtga

KEGG   Phascolarctos cinereus (koala): 110219415
Entry
110219415         CDS       T05867                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04810  Regulation of actin cytoskeleton
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw05100  Bacterial invasion of epithelial cells
pcw05135  Yersinia infection
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110219415 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110219415 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110219415 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110219415 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110219415 (FN1)
   05205 Proteoglycans in cancer
    110219415 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110219415 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110219415 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110219415 (FN1)
   05100 Bacterial invasion of epithelial cells
    110219415 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110219415 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110219415 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110219415 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110219415 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110219415 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:pcw04990]
    110219415 (FN1)
Membrane trafficking [BR:pcw04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    110219415 (FN1)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   110219415 (FN1)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110219415 (FN1)
Domain-containing proteins not elsewhere classified [BR:pcw04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   110219415 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 Glyco_hydro_66
Other DBs
NCBI-GeneID: 110219415
NCBI-ProteinID: XP_020858394
UniProt: A0A6P5LPQ3
LinkDB
Position
Unknown
AA seq 2484 aa
MHRDPVPGRRLLLLLLLALCMGTSAQAAKSTKNRRQAQQMIQPPSPVAVSQSKTGCYDNG
KHYQINQQWERIYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPK
DSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGE
WTCKPVAERCYDNTGGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDT
KTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHSSLQTTATGPGSVTDVRTALYQP
QPQPQPAPYGHCVTDSGVVYSLGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSN
GEPCVLPFTYNGRTYYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDQTVLVQTRGGNSN
GALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTINYDADQKFGFCPMAAHEEICTTNEGV
MYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDGITYNVNDTFHKRHE
EGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKYVHAVRYQCYCYGRGIGE
WHCQPLQAYPGATGPVQVIITESPSQPNSHPIQWNAPEPSHISKYILRWKAKNSPGRWKE
ATIPGHLNSYTIKGLRPGVIYEGQLISIQQSGHKEVTRFDFTTTSTSPAVSTNTVIGETT
PFSPLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVN
IPDLLPGRKYIVNVYQISEEGEQNLILSTSQTTAPDAPPDPAVDRVDDTSIVIRWSRPQA
PITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIFAVEENLESTPVFIQQ
ETTGVQRPDKVPPPTDLQFVEVTDVKVTIMWRPPESAVTGYRVDVVPVNLPGEHGQRLPV
SRSTFAEVTGLSPGVTYYFKIFAVNHGKESKPLTGEQTTKLDAPTNLRFVNETDTTVLVI
WTPPRAKIAGYRLTVSPTRGNQPKQYNVGPSATQYPLRNLQPGSEYTASLVAVKGNQQSP
KQTGIFTTLQPASSIPHYNTEVTETTIIITWTPVPRIGFKLGVRPSQGGEAPREVTSESG
SIVVSGLTPGVEYVYTVSVLRDGKEKDAPIVKKVVTPLSPPTNLHLDANPDTGILTVSWE
RSTTPDISGYRITTTPTNGREGYSLEEVVHGDQSSCTFENLSPGLEYNVSVYTVKGDKES
VPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNASTIIGYRITVVAAGEGIPIFEDFV
DSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRV
TWAPPPSIELTNLLVRYSPVKNEEDVAELTISPSDNMVVLTNLLPGTEYLVSVSSVYEQH
ESIPLKGRQKTGLDSPTGIDFSDITANSFTVHWMSPRAPNTGYKIRHHPEHASGRPREDR
VPPSRNSITLTNLNPGTEYVVSIVSVNGREESAPLVGQQSTVSDVPRDLEVIATTPNSLL
ISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGTKSTATISGLKPGVDYTITVYAVTGRG
DSPASSKPVTISYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTAPKNGPGPS
KTKMTGPDQTEMTIEGLQPTVEYVVSIYAQNQNGESQPLVQTAVTNIDRPKGLAFTDVDV
DSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVAL
HDDMESQPLIGTQSTAIPSPANLKFTQVSPTSFTVQWTAPDVQLTGYRVRVTPKEKTGPL
TKEINLAPDSTSAVVSGLMVATKYEVSIYALKDALTSRPAQGVVTTLENVSPPRRARVTD
ATETTITINWRTKTETITGFQVDAIPSNGQSPVQRTISPEIRSYTITGLQPGTDYKIHLY
TLNDNTRSSPVVIDASTAVDAPSNLRFLTTTPNSLLVSWQPPRARITGYIIKYEKPGSPA
REVVPRPRPGVTEATITGLEPGTEYVIYVIALKNNQKSEPLIGRIKTDELPQLVTLPHPN
GPEILDVPSTVQKTPFITNPGYDNGNGIQLPGTTGQQPSVGQQMIFEEHGFRRTTPPTAA
TPIRHRPRPFPPNVDEEIQIANIPRGDADHLPYPHVLGLNPNASTGQEALSQTTISWTPF
QESSEYIISCHPIGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEALKNQRRHKVREE
MVTVGNSVNEGLTQPTDDTCFDPFTVSHYSIGEEWERLSDSGFKLWCQCLGFGSGHFRCD
SSKWCHDNGVNYKIGDKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGE
QWQKEYLGAICSCTCFGGQQGWRCDNCRRPGVETPPEGSAGHSYNHYSQRYHQRTNTNVN
CPIECFMPLDVQADTENSRDSREK
NT seq 7455 nt   +upstreamnt  +downstreamnt
atgcacagggacccagtcccgggacggcggctgctgctgctgctgctacttgcgctatgt
atgggaacatcagcgcaagcggcaaaatcgacgaaaaaccggagacaagcccagcaaatg
attcagcctccgtccccggtggctgtcagccaaagcaaaactggctgttatgacaatgga
aaacactaccaaatcaaccaacaatgggagcgaatttacttgggcaatgcactggtttgt
acctgctatggaggcagccgaggttttaactgtgagagcaaacctgaacctgaagagaca
tgcttcgacaaatatactgggaacacttaccgggtcggggacacttatgagcgcccaaag
gattcaatgatttgggattgtacctgcattggggctggtcgagggagaatcagctgtacc
attgcaaatcgctgtcatgaagggggtcagtcctacaaaataggagacacctggcgccga
cctcatgagacaggaggctacatgcttgagtgtgtttgtcttggtaatggaaaaggagaa
tggacctgcaaacctgtagctgaaaggtgctatgacaacaccggtgggacctcctatgtt
gttggagagacttgggagaagccctatcagggctggatgatggtggattgtacctgctta
ggagaaggcagtggacgcatcacctgtacctctagaaatagatgtaatgatcaggacacc
aagacatcctaccgaattggagatacctggagcaagaaagacaatcggggaaatttgctt
cagtgtatctgtactggtaatgggaggggagaatggaaatgtgaaagacattcatctttg
caaacaactgctacagggcccggctcagtcacagatgttcgaacagcactgtaccagccc
cagcctcagccccagcctgctccatatggtcattgtgtcactgatagtggagtggtctac
tctctgggaatgcaatggctcaagacccaaggaaacaaacaaatgttgtgcacgtgtctg
ggcaatggtgtcagctgccaagagaccgctgtaactcaaacctatggtggcaattccaat
ggagaaccatgtgtcctgccattcacatacaatggcaggacttactattcctgtacaact
gaaggtcgtcaggatggacatctctggtgtagcaccacttcaaattatgaacaagaccag
aaatattctttctgtacagaccagactgttttggttcagactcgagggggtaactccaat
ggtgccctgtgtcacttcccattcttgtacaacaaccgtaactacactgactgtacctcc
gagggacggcgagataacatgaagtggtgtggcaccactatcaactatgatgctgatcag
aagtttgggttctgtcctatggctgcccatgaagagatctgcaccaccaatgaaggggtc
atgtatcgcattggagatcagtgggacaaacagcacgacatgggccacatgatgagatgc
acgtgtgtaggaaatggtcgtggggaatggacctgtgtggcgtactcacagctcagagat
caatgtatcgtcgatggcatcacctataatgtgaatgatacattccacaagcgtcacgaa
gaaggtcacatgctgaattgcacatgttttggccagggccgtggaagatggaaatgtgac
cctattgaccaatgccaggattcagaaacccgtacattctaccagattggagattcatgg
gagaaatatgttcatgctgtcagatatcagtgctactgttatggccggggcattggagag
tggcattgccaacctttgcaggcctatccaggtgcaactggtccagtccaagtaatcatc
actgaaagccccagtcagcccaactctcatcctatccagtggaatgcacccgagccatct
cacatttccaagtacattctcagatggaaggctaaaaattctccaggtcgttggaaagag
gctactattcctggtcacttaaattcttacacaatcaaaggtctacggcccggtgtgatt
tatgagggacagcttatcagtatacaacagtctggacacaaggaagtcactcgctttgac
ttcactaccaccagcaccagccctgctgtgtccaccaacacagtcataggcgagacaacg
ccattttctcctcttgtcgcgacttcggaatctgttacggaaattacagccagcagcttt
gtggtctcctgggtctcagcctctgacaccgtctctggattccgggtggagtatgagctg
agtgaggagggtgatgagccacaataccttgatcttccaagcacagccacctccgttaac
atccctgacttgcttcctggccgcaaatacattgtaaatgtctatcagatctctgaagaa
ggagaacaaaatctgatcctgtctacctcccagacaacagcacctgatgctcctcctgac
cctgcagtggacagagtagatgacacttcaattgttattcgctggagcagaccacaggcc
cccatcacaggttacagaatagtctattccccatcagttgaaggaagcagcacagagctc
aatctcccagaaactgctaattctgtaactcttagtgacttgcaacctggggttcagtat
aacatcactatttttgctgtggaggaaaatctagagagcacccctgtcttcattcagcaa
gaaaccactggcgtccagcgtccagacaaggttcctccccctacggaccttcaatttgtg
gaagtgacagatgtcaaagtcaccatcatgtggaggccccctgaaagtgcagtgactggc
taccgagtggatgtagtccctgtcaatctccctggggagcacgggcagaggctgccagtc
agcaggagtacctttgctgaggtcactgggctctcccctggagtcacctactacttcaag
atctttgcagtgaaccatggaaaggagagcaagccattgacaggagaacagaccaccaaa
ctagatgctcctactaacttaaggtttgtcaatgagactgacaccacagtcttggttatc
tggactccacctcgtgccaagatagcaggatatcgactgactgtaagccctacaagagga
aaccagcctaagcagtataatgtggggccatctgccacccagtacccactgaggaatctg
cagccaggatctgagtacactgcttccttggtagctgtgaaaggcaatcaacagagtcct
aagcaaactggaattttcactaccttgcaacctgccagttccattcctcattacaacaca
gaagtgaccgaaacaacaatcatcatcacctggaccccggtcccaagaatcggttttaag
ttgggtgtacgaccaagtcaaggcggagaagctccccgtgaggtgacttcagagtctgga
agcattgttgtgtctggtctaactccaggggtggaatatgtatatactgtttcagtccta
cgagatggtaaagagaaagacgctccaattgtgaagaaagtggttacaccactgtctcca
ccaaccaaccttcacttggatgcaaaccctgacactggaatcctaactgtctcctgggaa
agaagcaccaccccagacatctctgggtacagaataaccaccacacctacaaatggccga
gagggttattctctggaagaagtggtccatggagatcagagttcctgcacttttgaaaac
ctgagtcctggcctagagtacaatgtcagtgtgtacactgtcaaaggtgacaaggaaagt
gtccccatctccgataccatcatcccagaggtaccccaactcactgacctaagctttgtt
gatataaccgattcaagcatcggcctgaggtggaccccgctaaacgcctccaccattatt
gggtaccgcatcacagtagttgcggcaggagaaggtatccctatttttgaagattttgtg
gactcctcagtaggatactacacagttacagggctggagccgggcattgactatgacatc
agcgttatcactctcattaatggcggagagagtgcccctaccactctgacacaacaaacg
gctgtccctcctcccactgacctgcgattcaccaatgttggcccagacaccatgcgtgtg
acctgggctccaccaccatctattgaactgactaacctactggtacgatattcacctgtg
aaaaacgaggaagatgttgcagagttgaccatttccccttcagataacatggtggtccta
acaaatctccttcctggtactgagtatttggtcagcgtttccagcgtgtatgaacaacat
gagagcatacctcttaaaggaagacagaaaacaggtcttgattccccaactggcattgac
ttttctgatataactgccaactccttcactgtccattggatgtctccacgagcccccaac
actggctacaagattcgccaccatcctgaacatgctagtggaagacctcgtgaggaccgt
gtccccccctcaaggaactccatcacacttactaacctgaatccaggcacagagtatgtg
gtcagcattgtatctgtcaatggcagagaagaaagcgcccctttggttgggcaacagtca
acagtttctgatgttccaagggaccttgaagttattgctactaccccaaacagcctgctt
attagttgggatgcacctgccgttaccgtcagatattatagaatcacttatggtgaaaca
ggaggaaatagccctgtgcaggagttcactgtgcctggtaccaaatctacagccaccatc
tctggccttaagcctggagtagattataccatcactgtatatgcagtaactggtcgtgga
gacagtccagccagcagcaaacctgtgaccatttcataccgaacagaaattgataagcca
tcccaaatgcaagtgactgatgtgcaggacaacagcatcagtgtgaggtggctgccttca
agttctccagttaccggttacagagtgaccactgctcccaagaatggccccggaccatct
aaaacaaaaatgacaggcccagatcaaacagaaatgaccattgagggactgcagcccaca
gtagagtatgtggttagcatctatgctcagaatcaaaatggagagagtcagcctctggtt
cagacggcagtcactaacattgatcgccctaaaggactggcattcactgatgtggatgtc
gattccatcaaaattgcttgggaaagcccacaggggcaagtttccaggtatagggtgacc
tactcaagccctgaggatggaatccatgagctatttcccgcccctgatggtgaagaagac
acagcagaactgcagggcctcaggccggggtctgagtacacagtcagtgttgttgccttg
cacgatgatatggagagccagcccctgattggaacccagtccacagctattccttcacca
gccaacctgaagttcactcaggtttctccaaccagcttcacagtacaatggacagcacct
gatgttcaactcactggatacagagtgcgagtgacacctaaggagaagacaggaccgttg
acaaaggaaatcaaccttgctccagatagcacctcagctgtggtgtcaggactgatggtg
gcgactaaatatgaagtcagcatctatgctctcaaggatgctctgaccagcaggccggca
cagggcgtagttactactttggaaaatgtcagtcctccacgtagggcccgtgtgacagat
gccacagagaccactatcaccatcaactggagaaccaagacagagactatcacaggcttc
caggttgatgctatcccatctaatggtcagagtcctgttcagagaactatcagcccagaa
atcagaagctataccatcaccggtttacaaccaggcactgattacaagattcacctctac
accctaaatgacaatacccgaagctcacctgtagtgattgatgcttcaactgctgttgat
gcaccatccaaccttcggtttctcacgaccacacctaattcactgctggtttcatggcag
ccaccccgagctcggatcactggctacatcatcaagtatgagaagcctgggtcacctgcc
cgagaggtggtccctcgacctcgtcctggggtcacagaggccactatcactggtctggaa
ccaggtactgagtacgtcatctatgtcattgccttgaagaataatcaaaagagtgaacca
ttgattggaaggataaagacagatgagcttccccaactggtaacccttccacaccctaat
ggaccagagatcttggatgttccctccacagttcaaaagacccctttcatcacaaatcct
gggtatgacaatggaaatggtatacagcttccaggcactaccggccagcaacctagtgtt
gggcaacaaatgatctttgaggaacatggctttaggcggactacaccacccacagcagca
acccccataaggcataggccaagaccattcccaccgaatgtagatgaggagattcagatt
gctaacatccccagaggggatgcagatcatcttccatatcctcatgttcttgggctcaat
ccaaatgcctctacaggacaagaagctctctctcagactaccatctcttggacaccattc
caggaaagttctgaatatatcatttcatgccatcccattggcattgatgaagaaccttta
cagttcagagttcctggaacttcagctagtgccacactgaccggccttaccagaggggct
acctacaacatcatagtagaggcactgaaaaaccagaggagacacaaagttcgggaagag
atggtcacagtgggcaactctgttaatgaaggattgacccaacctacggatgacacatgt
tttgatccattcactgtctctcactattccatcggagaggaatgggagcgattatctgac
tctggctttaaactctggtgccaatgcttaggttttggcagcggtcatttcagatgtgat
tcatctaaatggtgccatgacaatggcgtgaattacaagattggggacaagtgggatcgc
caaggagagaatggacagatgatgagctgcacctgtcttggaaatggaaaaggagaattc
aagtgtgatcctcatgaggccacctgttatgatgatggtaagacataccacgtaggggaa
cagtggcaaaaggagtaccttggggccatctgctcttgcacgtgttttggcggacagcag
ggctggcgctgtgacaactgccgaaggcctggggtggagaccccaccggaaggctcagca
ggccactcctacaatcactattctcagagatatcatcagagaacaaatactaatgtcaac
tgcccaatagagtgtttcatgcctttggatgtacaggcagacacagaaaattcacgagat
tcccgagaaaagtaa

KEGG   Phascolarctos cinereus (koala): 110222728
Entry
110222728         CDS       T05867                                 

Gene name
LAMB3
Definition
(RefSeq) laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110222728 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110222728 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110222728 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110222728 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110222728 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110222728 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110222728 (LAMB3)
   05145 Toxoplasmosis
    110222728 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF ATG16 Laminin_II DUF745 F5_F8_type_C Fib_alpha
Other DBs
NCBI-GeneID: 110222728
NCBI-ProteinID: XP_020863540
UniProt: A0A6P5LYG3
LinkDB
Position
Unknown
AA seq 1171 aa
MWPLLMLMALPGLLHAQQACSRGACYPPVGDLLVGRARFLKASSTCGMMKPETYCTPYGE
WQMKCCKCDSRLPHGYNSHRVENVVSSSGPMRWWQSQNDVSPVSLQLDLDRKFQLQDITL
DLQGPLPAGMLIEHSPDFGKTWKVYQYLSTNCATTFPQLRQGRPQNWQDVRCQPLSTQHT
GPNRGGKVHLNILDLASGIQATQNQKIHELGEITNLRVNFTRLAPVPQRGYHPPSAYFAV
SQLRLQGSCLCHGHADRCAPLPGTPADPSARVQVHDVCVCQHNTAGPNCDRCAPFYNNRP
WKPADDQNPHECQRCDCNGHSETCHFDPAVFAASQGVSGGVCDSCRDHTEGKNCERCQLH
YFRNRRPGAPIQETCIPCECDPDGAVQGAPCDPLTGQCVCKENVKGERCDLCKPGFTGLT
YANPQGCSRCDCSILGSRRDMPCDEETGRCLCLPNVVGPKCDQCAPHYWKVASGRGCEPC
NCDPHNSYSPQCNQFTGQCPCREGFDGPTCSAASIRQCPDRSYGDFGLGCRACDCDFRGT
EGPGCDKATGRCLCRPGFTGPRCDQCQRGFCDNYPVCVACHPCFHTYDSNIREEVLRLRA
LLNTTAGLRPGSGLEEHRLSPRMAEAENSIRQIQAILRTPSVTEQEITEVANIIFSVRRI
LQSLRTDLPLEGESDSLLEDLENLDRSLKLLLIQYQNKREQFERISSTDPSGSFRMLNSA
YQMSSQAAQRIASSSNLLLQAHNSRREAERLERQVEGTGGAGGPQLQTLRQQMASFPNLT
PTLNKICGTTRQETCTPGQCQGMLCPRDNGTACDADCRGILRRAGGAFRTAKQVSQQLQD
FNAQLQQTRQMIREAEEAATQIQTDAQRLEIQVSNSRSQMEEDVQRTRLLIQQVRDFLTD
PSTDAATIQEISESVLALWLPTDSATVLRKMNEIQAIAARLPNVDLILSQTKQDITRARK
LQEEAELARSRAIAVEGQVEDVVENLRQGTVALQEAENTMQGTSRSLGLLQDRITEVQQV
LTPTERMVTGMTEQLTNFRDRIEQLHTKIREQRAQSSQAQQIAQEANDHAVSAQQGFERV
KRKYAELKDRMGQSPTLGEQGDRILNVKSEAEELFEETMSMMDRMKDMEAELLLGSQAIT
QRSADLTGLEKHVEKIRDHINERVLYYATCQ
NT seq 3516 nt   +upstreamnt  +downstreamnt
atgtggcccctccttatgttgatggcactgccaggactccttcatgcccagcaggcctgt
tctcggggggcctgctaccctcctgttggggacctgttggttggaagggcacggttcctt
aaagcttcttctacctgtggaatgatgaagcctgagacctactgcaccccctatggcgag
tggcaaatgaaatgttgtaagtgtgactcccgtctgcctcatggttacaacagccaccgg
gtggagaatgtggtctcctcctctggccccatgcgctggtggcagtcccaaaatgatgtg
agccctgtttctctgcagttggatctggacaggaaattccagctccaggacatcacgttg
gacttacagggacctctaccagcaggcatgctgattgaacattccccagactttggcaaa
acttggaaggtgtatcaatacctgtctaccaactgtgctaccaccttcccccagctccgc
cagggccggcctcagaactggcaggatgttcggtgccaaccactgtcaacccagcacact
gggcccaaccgtgggggaaaggttcacctcaacattttggacttagcatctgggattcag
gccactcagaatcagaagattcatgagctgggggaaattaccaacttgagagtcaacttc
accaggcttgctccagtgccccagagaggttaccacccacccagtgcctactttgctgtg
tcccagctgcggttgcaggggagctgcctctgccatggccatgctgaccgctgtgctcct
ctccctggcacacctgccgacccctcagctagagtacaggtccatgatgtctgcgtttgc
cagcataatactgctggtcccaactgtgaccgctgtgctcctttctataacaaccggccc
tggaaacctgctgatgaccagaatcctcatgaatgccagaggtgtgactgtaatgggcat
tcagagacatgccactttgacccagctgtatttgctgccagccagggcgtgagcggaggt
gtgtgtgacagctgccgggaccacaccgaggggaagaattgtgagaggtgtcagctgcac
tacttccggaaccgccgcccgggtgctcccatccaggagacctgcatcccttgtgagtgt
gacccagatggggcagtgcagggggccccctgtgatccgctgactggacagtgtgtgtgc
aaagagaacgtgaagggggaacgctgtgacctgtgcaagcctggtttcactggactcacc
tatgccaacccacagggctgtagtcgctgtgactgtagcatcctgggatctcggcgagac
atgccctgtgatgaggagactgggcgttgcctatgcctgcccaatgtggttggtcccaag
tgtgatcaatgtgctccccattactggaaagtggccagtggcaggggctgtgagccatgt
aactgtgaccctcacaactcctacagcccacagtgtaaccagttcacaggtcagtgtcca
tgccgggaaggatttgatggcccgacgtgcagtgctgcatccatccgccagtgtcctgat
cggtcctatggagattttggtttagggtgtcgagcctgtgactgtgacttccggggcaca
gaaggtccaggctgcgacaaagccacaggccgatgcttgtgtcgcccaggctttactggt
ccccgttgcgaccagtgccagaggggcttctgtgacaactaccccgtctgtgtggcctgc
cacccctgcttccacacatatgatagcaacatccgagaggaagtcctgcgtctcagggcc
ctgctcaacaccacagctgggctccggccagggtctggcctagaggagcaccgactgagc
ccccggatggcagaggcagagaacagcattcgacagatccaggcgatcctccgaacgccc
tcagtcacagagcaagagataactgaggtggcaaatatcatcttctctgtcaggaggatc
ctccagagtctgaggacagatctgcccttagaaggggagtcagattcccttttggaagac
ctggagaatctggacagaagtcttaagctcctcctcatccagtatcagaacaagagagaa
cagtttgagagaattagtagcacggacccctcgggttccttccggatgttgaactctgcc
taccagatgtcttcccaagctgctcagcgtattgctagcagctccaacctgctgctccag
gcccataacagccggagagaagccgaaaggctggagaggcaggtggaaggaactggaggt
gctggggggccacagctccagaccttgaggcaacaaatggcttcctttcccaatctgaca
cccaccctcaacaagatttgcgggaccacaaggcaggagacctgtaccccagggcaatgc
caagggatgctgtgtccccgagacaatggcacagcctgtgatgctgattgtagaggcatc
ctccggcgggcaggcggtgccttcaggactgctaagcaggtgtcccaacagctccaggac
ttcaatgctcagctccaacaaaccaggcagatgatcagggaagcagaagaagctgccacc
cagatccagacagatgcccagcgcttggagattcaggtgagcaacagccgttctcagatg
gaggaggacgtccagcgcacccgcctcctcatccagcaggtccgggactttctcactgac
cccagcacagatgcagccaccatccaggagatcagtgagtcagttttggctctctggctg
cccacggactcagcaacagtccttcggaagatgaatgaaatccaggccattgcagccaga
ttgcctaatgtggacctgattctgtctcagaccaagcaggacatcactcgagctcggaag
ctgcaggaggaggcagaattggccaggagccgtgctattgccgtggagggtcaggtggag
gatgtggtggagaacttgcgccagggcacagtagctcttcaggaggcggagaacaccatg
caaggtaccagtcgctccctgggactccttcaggaccggatcactgaggtccagcaggtt
cttactccaacagaaaggatggtgacaggtatgacggagcagctgaccaactttagggac
cggattgagcagctccacaccaagattagggagcagagagcacagtcttcccaagcccag
cagattgcccaggaggccaatgaccatgctgtcagtgcccagcagggatttgagagagtg
aaacgaaagtatgcagaactgaaggaccggatgggtcagagccccacgctgggggagcag
ggggaccggatcctgaatgtcaagtctgaggctgaagagctctttgaggagaccatgtct
atgatggacaggatgaaagatatggaagcagagctgctgctgggaagccaggctatcacc
cagcgctcagcagacctgactggtttggaaaagcacgtggagaaaatccgggaccacatt
aatgagcgagtgctgtactatgccacctgtcaatga

KEGG   Phascolarctos cinereus (koala): 110222892
Entry
110222892         CDS       T05867                                 

Gene name
LAMA4
Definition
(RefSeq) laminin subunit alpha-4 isoform X1
  KO
K06241  laminin, alpha 4
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw05143  African trypanosomiasis
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110222892 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110222892 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110222892 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110222892 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110222892 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110222892 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110222892 (LAMA4)
   05145 Toxoplasmosis
    110222892 (LAMA4)
   05143 African trypanosomiasis
    110222892 (LAMA4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3 DUF2513
Other DBs
NCBI-GeneID: 110222892
NCBI-ProteinID: XP_020863812
UniProt: A0A6P5LZ62
LinkDB
Position
Unknown
AA seq 1824 aa
MALISAWSYAFPILLFLGCFSSSTAAVEGSAFPFDIEGSSAISKQEAADNREPSLAAGSP
VPFAEICGAGFFHSVSGECLPCDCNGNSNECLDGSGFCVNCQRNTTGEHCEKCPDGYIED
VSRGAPRSCQPCPCPLPHMANFAVSCYRKSGVVRCICKEKYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSETGECLEESFEPPTGTDCPTISKSCDKCIWDLTDDLRLAALAIDESKSNL
LSVSSGVAAHRHVNEINSTVYLLKAKFSERENQYLLRKIQISDVENTMKGLLSDLEELAE
KENQASKKSQLVQKETMDTINYATQLVEEAHNMRDKIQEISNKMLYYGVEQNLSPEEISE
KLALAEDMLEEIRRRKPFLLQRETADEEADEAQELLSLAENWQRLHNDTRSLFPVVLEQL
DDYDAKLSELQESLDESLDRVRDAEDTNRANAARQRDNEKQHERVKEQVEVVNTSLSESA
ESLEIPRLTISELSDVIKNASGIYAEIDGAKKELQDKLSNLTTLDHNLVQRAVEHAQDLQ
QQADELNRSLHRLDTNGLVQKALDASNVYENIINYVHEANESAVLALSITDRVNDAVGGI
DTQITYHKDESENLLSQAKTLQATADSSDEQAVADTSQRVDGAQARKSILKNRLNEAIKK
LQAAERGDAEQRLDHSKRIIAEAEKTTMVVGQATTPMVNNLSNWSQSFHHFDSSAYNTAV
DSARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSDSIRRIRELIAQTRSVASKIQVSMMF
DGQSAVEVNTKTSVDDLKAFTSMSLYMKPPAKEAMKNENADRFILYLGSKNGKSDYMGLA
IKNDNLVYIYNLGNKDVEIPLDSKPVSTWPAHFSIVKIERVGKHGKVFLTVPSLTSTAEE
KFIKKGEVSGDDSLLDLQPEDTVFYVGGVPPNFKLPASLNLPGFIGYLELSTLNNEVISL
YNFKHIYNMDPSKSIPSARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIE
VRTPTANGLVLLMVNGSTFFSLEMRNGYLNVFYDFGFSNGPVHLEDSQKKAPINDAKYHE
ISIIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEVLQSSNIKVHLLLDVNF
RGCMKGFQFQKKDFNLLEQPETLGVGYGCPEDSLISRRAYFNGQGFIASSQKISFFDAFE
GGFNFRTLQPNGVLLYYAAGSDIFSISMDKGTVILNVKGIKVQSTDKQYDDGQSHFIIAS
ISPTRYELIVDKDKLGKNNPSKGKMEQTPARESKFYFGGSPVSSQYANFTGCISNAYFTR
LDRDVEVEDFQRYSEKVHTSLYECPIESAPVSILHKKGKNSSKPKVDKNKKSEKNKDSPR
NPIGLKSLKQNVSRDSHCQLSSSPKAISHAYQYGGTANSRQEFEHLKGNFAERSQFSIRL
KTRSSHGMIFYISDQEENDFMTLFVAHGRLVFMFNVGHRKLKLRSQERYNDGLWHDVIFI
RDKSSGRLIIDGLRVLEESFPPTGTDWKVEGPIYLGGVAPGKAVKNVQINSVYSFSGCLS
NLQLNGTSITTASQTFSVTPCFEGPMESGTYFSAEGGYVILDESFNIGLKFEIAFEVRPR
SSSGILVHGHSVNGEYLNVHMKNGQVITKVNNGIRDFSTSVTPKQSLCDGRWHRITIIRD
SNVVQLDVDSEVNHVVGPLNPKSVDHREPVFVGGVPESLLTPSLTTGSPFSGCIRNFVID
ERPVSFSKAALVSGAVSINSCPAA
NT seq 5475 nt   +upstreamnt  +downstreamnt
atggctttgatctctgcctggtcttatgcttttcctatactgctcttcttgggatgcttc
tcctccagcactgcagcggtggagggcagcgcttttccgtttgacattgaaggtagttct
gcaatcagcaaacaagaggcggctgataacagagagccatcactagctgctggaagtccg
gtgccttttgctgagatctgtggagcaggattttttcactctgtgtctggagaatgtttg
ccctgtgactgtaacgggaattcaaatgagtgtctggatggctctggcttctgcgtgaat
tgtcaacggaacaccaccggagagcactgtgaaaagtgtccagatggctacattgaggat
gtcagcagaggagctcctagatcctgccagccatgcccttgccccttgccccatatggcc
aattttgcagtgtcctgctataggaaaagtggggtggtacggtgcatttgtaaagaaaaa
tatgctggacccaactgtgaaaggtgtgcccctggttactatggaaaccctttactgatc
gggagcacctgcaagaaatgtgactgcagtggaaattcggatcccaacctgatatttgag
gattgtgatgaagttactggccaatgtcgcaactgcttacggaataccaccggattcaaa
tgtgaacggtgtgcccctggatattatggggatgccaggatagccaagaactgtgcagta
tgcaattgtgggggaggaccatgtgacagtgaaactggagaatgccttgaagaaagtttt
gaacctcctacaggcacggactgcccaactataagtaaaagctgcgacaaatgcatctgg
gatttgactgatgacctacgattagcagctcttgctattgatgaaagcaaatcaaatttg
ttgagtgtgtcatctggagtagctgctcaccggcatgtaaatgaaatcaattccactgtt
tacctcctcaaggcaaagttttcagaaagagaaaaccaatacctcctaagaaaaatacag
atcagtgatgttgagaatacaatgaagggtcttctatctgatttggaggaactagctgaa
aaggaaaatcaagcctcaaaaaaaagccagctggttcagaaggaaaccatggataccatt
aactacgcaacccagcttgtagaagaagcccacaatatgagggataagatccaagagatc
agcaataagatgctatattatggagttgagcagaaccttagcccagaagaaatctctgaa
aagcttgcattagcagaggacatgctggaggaaatcaggcgccgaaagccattcctcctt
caaagggaaactgcggatgaagaggctgatgaagcgcaagaattgttgtccctcgccgaa
aactggcaacggcttcacaatgatacaaggtcgctgtttcctgttgtattagagcagctt
gatgactatgatgccaagttgtcagaacttcaggagtcactggatgagtctcttgaccgt
gtccgagacgctgaggatacgaacagagccaatgctgccagacaacgggacaatgagaaa
caacatgaaagagtcaaagaacaggtagaggtggtgaacacttctttgagtgaatctgca
gaatctctggaaatccctcgtctgaccatttctgagctaagtgatgtcattaagaatgct
tcaggaatttatgcagaaatagatggagccaaaaaagagctacaagacaaactctctaat
ttgactaccctcgatcataacttggtccagcgggctgtagagcatgcacaggaccttcag
caacaggctgatgagctaaatagaagtctgcacagattggatactaatggattagtacag
aaggcactagatgcatcaaatgtctatgaaaacatcatcaactatgtccatgaggccaat
gaatcagcagtactagccttgagcattacagacagagtcaatgatgctgtaggtgggatt
gacactcagatcacttaccataaagatgaaagcgaaaatcttctcagtcaagccaagaca
ttgcaagcaacagcagattctagtgatgagcaggctgtggccgacaccagccagcgtgtg
gatggagcccaggctcgaaagagtattctgaaaaacaggctaaatgaagctattaagaaa
cttcaagcagcagagagaggggatgcagagcaacgtctggatcactcaaagcgaatcatt
gcagaagctgagaagacaaccatggtggtaggccaagccaccaccccaatggtgaacaat
ctaagcaactggtcacagagctttcaccattttgattcctcggcctacaacactgcagtg
gactctgctagagatgcagtaagaaatttgacagaagtcgtccctcagctcctggatcag
ctgcgcacagtagagcagaagaggcctgcgagcaacgtttcagacagcattcggaggatc
agagagctcattgcacagaccaggagtgtagccagcaagattcaagtctccatgatgttt
gatggtcagtcagcagttgaagtcaacacaaaaactagcgtggatgacttaaaagctttt
acttccatgagcttatacatgaagcctccagcaaaggaagcaatgaagaatgagaatgca
gatagattcatcttatatcttggaagcaaaaatggaaaaagtgattatatgggtcttgca
atcaagaatgataacctggtatacatttataatctgggaaacaaagatgtggagattcct
ctggactctaaaccagtcagcacttggcctgcccacttcagtattgtcaaaattgaaagg
gtagggaaacatgggaaggtattcctaacagtcccaagcctgaccagcacagctgaagaa
aagtttatcaagaaaggagaagtctctggtgatgattccctgcttgatttgcagccagaa
gacactgtcttttacgttggtggagtgccaccaaattttaagctccctgctagtttgaac
ctccctggtttcattggctatctggagttgtccactttgaataatgaggtgatcagctta
tacaattttaagcacatctacaacatggacccttcaaaatcaatacccagtgcaagagat
aaactggccttcactcaaagccgggctgccagttatttctttgatggttcaagttatgct
gtggtgagggacatcacaaggagaggaaaatttggacaagtgacacgttttgacattgaa
gttagaacaccgacagccaatggattggtgctcctcatggtgaatgggagtacatttttc
agcctggagatgaggaatggctacctgaatgtgttttatgactttgggttcagcaatggc
cctgtgcatctagaagactcccagaagaaagcaccaattaatgatgcaaaataccatgag
atttctatcatctaccacaatgataaaaagatgattttggtagttgacagacggcatgtg
aaaagcatggataatgaaaaaatgaaaataccttttacagatatatacattggaggagct
cctccagaagtcttacaatccagtaatataaaagtacaccttctattagatgtcaacttc
aggggctgcatgaagggtttccagttccaaaagaaggatttcaatttattggagcagcca
gaaactttgggagttggttatggttgcccagaagactcacttatatcccgcagagcatat
ttcaatggacagggtttcattgcttcaagccagaaaatatctttcttcgatgcctttgaa
ggaggttttaatttccggacattgcagcccaatggagtactactctattatgctgcaggg
tcggatatattctccatttccatggataagggaacagtgatattgaatgtaaaggggatc
aaagttcaatcaacagataaacagtacgatgatggtcagtctcatttcatcattgcctct
atatcacccacaagatatgaactcatagttgataaagacaaattgggtaaaaacaaccca
agcaaaggaaaaatggagcagactccggccagagagagcaagttctactttggtggctca
cctgtcagttcccagtatgctaattttaccggatgcataagcaacgcctatttcaccagg
ttggacagggatgtggaggttgaagatttccaacggtattctgagaaagtccacacctcc
ctctatgagtgccccattgaatcagcaccagtttctatcctccacaaaaagggaaaaaat
tcctcaaagcccaaagtagataagaacaaaaagagtgagaaaaataaagattcacctcgt
aatccaattggcctgaaatccctaaagcagaatgtttctcgggactctcactgtcagctt
tccagcagtccaaaagccatttcccatgcatatcagtatggagggacagctaacagccgc
caggagtttgaacatttaaaaggaaattttgctgaacggtctcagttttctattcgtttg
aaaactcgttcttcccatggaatgatcttctacatctctgatcaagaagaaaatgacttc
atgactcttttcgtggcacatggccgactagtcttcatgtttaatgttggccataggaaa
ctgaagcttaggagtcaggagaggtataacgatggattgtggcatgatgtgatatttatt
cgggataaaagcagtggtcgtttgataattgatggtcttcgggtcctggaagaaagtttt
cctccaactggcactgactggaaagtggagggtcctatttacttgggaggtgttgctcct
ggaaaagctgtaaaaaatgtccagattaattcagtctacagtttcagtggttgtcttagc
aatcttcagctcaatgggacctcaattaccactgcttctcaaacattcagtgtgactcct
tgttttgaaggaccaatggaaagtggaacatacttttcagcagaaggaggctatgtgatt
ctagatgagtctttcaatattggattgaagtttgagatagcatttgaagttcgtcccaga
agtagttcaggaatcttggttcatggtcacagcgtgaatggagagtacctgaatgttcac
atgaaaaatggacaggtcataacgaaggtcaacaatgggatcagagacttttctacttca
gttacacccaaacagagtctctgtgatggcagatggcacagaataacaattattagagat
tccaatgtggttcaattggatgtagattctgaagtcaaccatgtggttggtcccctcaat
ccaaaatcagttgatcacagggaacctgtttttgttggaggtgttccagagtctctcctg
acaccaagcttgaccacgggaagtcccttctctggctgcatccgaaacttcgtgattgat
gaacgcccagtgagcttcagtaaagcagcactggtcagcggggctgtgagcattaattct
tgtccagcagcctaa

DBGET integrated database retrieval system