KEGG   Phascolarctos cinereus (koala): 110195159Help
Entry
110195159         CDS       T05867                                 

Gene name
CHRNA10
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-10
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110195159 (CHRNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcw04040]
    110195159 (CHRNA10)
Ion channels [BR:pcw04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   110195159 (CHRNA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 110195159
NCBI-ProteinID: XP_020823444
LinkDB All DBs
Position
Unknown
AA seq 436 aa AA seqDB search
MYEGSRAAEGKLAQKLLHDLFTNYTSALRPVEDTDQALNVTLDVTLSQIIDMDERNQVLT
LYLWIRQEWADAYLHWEPEVYGGLDSIRIPSSMVWRPDIVLYNKADTQQPASASTNVVLR
HDGRVRWDAPAITRSSCRVDVAAFPFDSQSCRLTFGSWTHGGHQLDLWPGAPGARLADFV
ENVEWRVLGMPARRSVVTYGCCSEPYPDVTYTLLLQRRAAAYVANLLLPCVLISLLAPLA
FHLPADSGEKVSLGVTVLLALTVFQLLLAENMPPAESVPLIGKYYMTTMALVTASTALTI
LIMNLHYSGPGVRPVPAWAQTLLLGYLARGLCVRERGEPCGGSQHPAVPPHPSMHPKPRL
GPGSGAGPCPEPRCPCHQEALLRHVGAIAVTCRNHRAAQRLRGDWKRVARVVDRFFLAVF
FAMVLAMSLLVLGRAI
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaggctctcgagcagctgaagggaagcttgcacagaaactgctccatgacctc
tttaccaactatactagtgcccttcggcctgtggaggacacggatcaagctctaaatgtg
acactggatgtgactctgtcacaaattattgacatggatgaaagaaatcaggtgctgacc
ctgtacctgtggattcgccaggagtgggctgatgcctacctgcactgggagcctgaggtc
tatgggggtcttgactccataagaatccccagcagcatggtctggagacctgatatcgtg
ctctataacaaggcagacacgcagcagccggcctcggccagcacaaacgtggtccttcgc
cacgacggacgcgtgcgctgggacgcccccgccatcacccggagttcgtgtcgcgtggac
gtggcggcctttcctttcgactcgcagagctgccgcctgaccttcggctcctggacccac
ggcggccaccagctggacttgtggcccggcgctccaggtgccaggctggccgacttcgtg
gagaacgtggagtggcgcgttctgggcatgcctgcacggcggagcgtggtcacttacggc
tgctgctcagaaccctacccagatgtgacctacacgctgctgctccagcgccgagccgca
gcctacgtggccaacctcctgctgccctgcgtgctcatctcgttgctggccccgctcgcc
ttccacctgccagccgactctggggagaaggtgtctctgggagtcaccgtcctcctggcc
ctcaccgtctttcagctgttactggccgagaacatgcccccggcggagagcgtgcccctc
atcggcaagtactacatgactaccatggcgctagtgacagcatccacagcgttgaccatc
ctcatcatgaacctgcactacagtggccctggagtccgcccagtgccagcttgggcccaa
acacttctgttaggctatttggcccgaggcttgtgtgtccgggagcggggagagccttgt
gggggttcccagcaccccgcagttccgcctcacccctcaatgcaccccaagcctcgcctg
ggacccggatcaggagctgggccatgcccagagccacgttgtccctgtcaccaggaggcc
ctactccgtcacgtgggtgctattgctgtgacctgccgaaaccaccgggctgcccagcgt
cttagaggggactggaagcgtgtggcacgggtggttgaccgatttttcctggctgtcttc
tttgccatggtacttgctatgagcttgctggtcctgggccgtgccatctga

DBGET integrated database retrieval system