KEGG   Phascolarctos cinereus (koala): 110195563
Entry
110195563         CDS       T05867                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01523  Antifolate resistance
pcw04010  MAPK signaling pathway
pcw04014  Ras signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04137  Mitophagy - animal
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04218  Cellular senescence
pcw04380  Osteoclast differentiation
pcw04620  Toll-like receptor signaling pathway
pcw04621  NOD-like receptor signaling pathway
pcw04622  RIG-I-like receptor signaling pathway
pcw04623  Cytosolic DNA-sensing pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04657  IL-17 signaling pathway
pcw04658  Th1 and Th2 cell differentiation
pcw04659  Th17 cell differentiation
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04668  TNF signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw04917  Prolactin signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04926  Relaxin signaling pathway
pcw04931  Insulin resistance
pcw04932  Non-alcoholic fatty liver disease
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw05010  Alzheimer disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05030  Cocaine addiction
pcw05132  Salmonella infection
pcw05133  Pertussis
pcw05134  Legionellosis
pcw05135  Yersinia infection
pcw05140  Leishmaniasis
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05146  Amoebiasis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05203  Viral carcinogenesis
pcw05212  Pancreatic cancer
pcw05215  Prostate cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05321  Inflammatory bowel disease
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110195563 (RELA)
   04014 Ras signaling pathway
    110195563 (RELA)
   04064 NF-kappa B signaling pathway
    110195563 (RELA)
   04668 TNF signaling pathway
    110195563 (RELA)
   04066 HIF-1 signaling pathway
    110195563 (RELA)
   04071 Sphingolipid signaling pathway
    110195563 (RELA)
   04024 cAMP signaling pathway
    110195563 (RELA)
   04151 PI3K-Akt signaling pathway
    110195563 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110195563 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    110195563 (RELA)
   04218 Cellular senescence
    110195563 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110195563 (RELA)
   04621 NOD-like receptor signaling pathway
    110195563 (RELA)
   04622 RIG-I-like receptor signaling pathway
    110195563 (RELA)
   04623 Cytosolic DNA-sensing pathway
    110195563 (RELA)
   04625 C-type lectin receptor signaling pathway
    110195563 (RELA)
   04660 T cell receptor signaling pathway
    110195563 (RELA)
   04658 Th1 and Th2 cell differentiation
    110195563 (RELA)
   04659 Th17 cell differentiation
    110195563 (RELA)
   04657 IL-17 signaling pathway
    110195563 (RELA)
   04662 B cell receptor signaling pathway
    110195563 (RELA)
   04062 Chemokine signaling pathway
    110195563 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110195563 (RELA)
   04917 Prolactin signaling pathway
    110195563 (RELA)
   04926 Relaxin signaling pathway
    110195563 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110195563 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110195563 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    110195563 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110195563 (RELA)
   05202 Transcriptional misregulation in cancer
    110195563 (RELA)
   05203 Viral carcinogenesis
    110195563 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110195563 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110195563 (RELA)
   05221 Acute myeloid leukemia
    110195563 (RELA)
   05220 Chronic myeloid leukemia
    110195563 (RELA)
   05215 Prostate cancer
    110195563 (RELA)
   05222 Small cell lung cancer
    110195563 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110195563 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110195563 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    110195563 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    110195563 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110195563 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110195563 (RELA)
   04931 Insulin resistance
    110195563 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110195563 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110195563 (RELA)
   05135 Yersinia infection
    110195563 (RELA)
   05133 Pertussis
    110195563 (RELA)
   05134 Legionellosis
    110195563 (RELA)
   05152 Tuberculosis
    110195563 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110195563 (RELA)
   05170 Human immunodeficiency virus 1 infection
    110195563 (RELA)
   05162 Measles
    110195563 (RELA)
   05164 Influenza A
    110195563 (RELA)
   05161 Hepatitis B
    110195563 (RELA)
   05160 Hepatitis C
    110195563 (RELA)
   05168 Herpes simplex virus 1 infection
    110195563 (RELA)
   05163 Human cytomegalovirus infection
    110195563 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110195563 (RELA)
   05169 Epstein-Barr virus infection
    110195563 (RELA)
   05165 Human papillomavirus infection
    110195563 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110195563 (RELA)
   05145 Toxoplasmosis
    110195563 (RELA)
   05140 Leishmaniasis
    110195563 (RELA)
   05142 Chagas disease
    110195563 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110195563 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110195563 (RELA)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110195563 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 110195563
NCBI-ProteinID: XP_020824045
LinkDB
Position
Unknown
AA seq 537 aa
MEDLLPMIFASDSPPARGPFVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKIVGYTGPGTVRISLVTKEPPHRPHPHELVGKDCRDGFYEAELCPDHCIHSFQNLGIQC
VKKRDLEQAIAHRVQTNNNPFNVPLEEQRGDYDLNAVRLCFQVTIRDPAGRPLVLPPVLS
HPIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFTGPGWEARGSFS
QADVHRQVAIVFRTPPYAEPALQAPVRVHMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTLGTFKNIMKTSPFSVGSSDAWTPPRRIAVPSRGAKPPGVLPGLPSSVSQPYAFPP
PLSTINLEEFTPMVFSSGQVPAPSLAPAPTPAPSLVPAPPTTTPAPVPPQLSQSGEGTLS
EALLGLQFDTDGDLAELLGDPDSTYTNLAAIDNSEFQQLLNQGMAGPLEGPGPSGEPMLM
EYPESITRLMTGPQRPPEPNPAPPGASALSNGLVGADEVFPSMGDMDLSAFLSQISS
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggaggacctgttacccatgatcttcgcctcggattctcccccggcccgaggtccgttc
gtggagatcatcgagcagcccaagcagcgggggatgcgcttccgctacaagtgcgagggc
cggtctgcgggcagcatccccggggagcgcagcacggacaccaccaagacgcatcccacc
atcaagattgttggctacactggaccaggaactgtccgcatctctctggtgaccaaggag
ccccctcaccggcctcacccccatgagttggtggggaaggactgtagggatggcttctat
gaggctgaactctgccctgatcactgcatccacagctttcagaacctggggattcagtgt
gtgaagaagcgagacctggagcaggccatcgcccatcgagtgcagaccaacaataatccc
ttcaatgtgcccctggaagaacagaggggagactatgacctgaatgccgtccggctctgc
ttccaagtgaccatccgggaccctgcaggcaggcccctcgtcctgccccctgtcctctcc
catcccatctatgacaaccgggcccccaacaccgccgagctgaagatctgccgtgtgaac
cgtaactcgggcagctgcctgggcggggatgagatcttcctcctctgtgacaaggtgcag
aaagaggacatcgaggtgtgcttcacggggccgggctgggaggcacgtggatccttctcg
caggccgacgtgcacaggcaggtggccatcgtgttccgcacaccgccgtatgcagagcct
gccttacaggccccggtacgggtgcacatgcagcttcggcggccatccgacagggagctc
agtgagcccatggagttccagtatctgccggacacagatgatcggcaccgaatcgaagaa
aagcgcaagaggaccctgggcacctttaagaacatcatgaaaacgagtcctttcagtgta
ggcagttctgatgcctggacgcctcctagacgcatcgcggtgccctcccgcggtgccaag
cccccaggtgtcctccctggcctgccttcctccgtctcccagccctacgccttcccccca
cctcttagtaccatcaatttggaggagtttactcccatggtcttttcatctggccaggtc
ccagccccatccctggcccctgctcccacgcctgctccttccctggttcctgccccaccc
acaacaacccctgcccctgtcccaccccagctctcccagtctggggagggaacgctgtct
gaggccctcctgggccttcagtttgatacagatggagatctggccgagctcctgggtgac
cctgacagtacatacaccaaccttgcagccatcgacaactctgagttccaacagctgctg
aaccagggaatggcagggcccctggaaggtcctgggccctcaggggagcccatgctgatg
gagtaccccgagtcaatcactcgccttatgacagggcctcagcgaccccccgagcccaac
cctgcccctccaggagcctcagcgctctccaacggtctggtgggggcagatgaagtcttc
ccctccatgggggatatggacctatcagccttcctgagtcagatcagctcttaa

DBGET integrated database retrieval system