KEGG   Phascolarctos cinereus (koala): 110196807Help
Entry
110196807         CDS       T05867                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00010  Glycolysis / Gluconeogenesis
pcw00053  Ascorbate and aldarate metabolism
pcw00071  Fatty acid degradation
pcw00280  Valine, leucine and isoleucine degradation
pcw00310  Lysine degradation
pcw00330  Arginine and proline metabolism
pcw00340  Histidine metabolism
pcw00380  Tryptophan metabolism
pcw00410  beta-Alanine metabolism
pcw00561  Glycerolipid metabolism
pcw00620  Pyruvate metabolism
pcw01100  Metabolic pathways
Module
pcw_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110196807 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    110196807 (ALDH2)
   00620 Pyruvate metabolism
    110196807 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110196807 (ALDH2)
   00561 Glycerolipid metabolism
    110196807 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110196807 (ALDH2)
   00310 Lysine degradation
    110196807 (ALDH2)
   00330 Arginine and proline metabolism
    110196807 (ALDH2)
   00340 Histidine metabolism
    110196807 (ALDH2)
   00380 Tryptophan metabolism
    110196807 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110196807 (ALDH2)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110196807 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110196807
NCBI-ProteinID: XP_020825856
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MLRAAALLGPRLGRRCLSLAASATVPTPNEHPEIFYNKIFINNEWHDAISQKTFPTINPS
TGDVICQVAEGDKADVDKAVKAAREAFRHGSPWRKMDASERGKLLNRLADLIERDRAYLA
TLETLDNGKPYSISYLVDLDMVVKCIRYYAGWADKYHGKTIPMDGDYFSYTRHEPVGVCA
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIIPG
YGPTAGAALASHMDVDKVAFTGSTEVGSLIQVAAGSSNLKKVTLELGGKSPNIILSDANM
DLAVEQAHFALFFNQGQCCCAGSRTYVQEDIYSEFVERSVARAKARVVGNPFDSRTEQGP
QVDKEQYKKILGYISSGKDEGAKLLCGGGPAADRGYFIQPTIFGDVQDNMTIAREEIFGP
VMQIMKFKTVEEVVERANDSRYGLAAAIFTKDLDKANYLSQVLQAGTVWINCYDVFGAQC
PFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgggccgcagccctgctcgggccccgtctgggccgccgctgtctgtccttggcc
gcttcggccaccgtgcccacccccaacgagcaccccgagatcttctacaacaagattttc
ataaacaacgagtggcatgatgccatcagccagaagactttccccaccatcaacccatcc
accggggatgtgatctgtcaagtggccgagggggacaaggcagacgtggacaaggcagta
aaagccgcgagagaggcgtttcgccatggctccccgtggaggaagatggatgcatcggag
agaggaaagctcttgaaccgattggcagacctgatcgagagggaccgggcttacttggcc
acgctggagaccttggacaacggcaaaccctactccatctcctacctcgtggatttggac
atggttgtcaaatgcattcggtattacgcgggctgggctgacaagtaccacgggaagacc
atccccatggatggagattatttcagctacacacgccatgagcctgttggggtgtgtgcc
cagatcattccgtggaacttcccactgctgatgcaggcctggaaactgggaccggccttg
gccacgggaaacgtggttgtgatgaaggtggccgagcagacgcccctgacggccctctac
gtggccaacctgatcaaggaggctggcttcccccctggagtggtcaacatcatccccgga
tacggcccgacggctggcgccgccctcgcttcccacatggatgtggacaaggtggcgttc
actggctccaccgaggtcgggagcctcatccaggtagccgcagggagcagcaacctgaag
aaggtgacactggagctgggcggcaaaagccccaacatcatcctgtctgatgccaacatg
gacttggccgtggagcaggcccactttgctctgttcttcaaccagggtcagtgctgctgt
gctggctccaggacctacgtgcaggaggacatctactctgagtttgtggagaggagtgtg
gcccgggccaaggctcgggtggtggggaatccctttgacagccgcaccgagcaggggcct
caggtagataaagaacagtataagaagattctaggctacatcagttcagggaaagatgag
ggagccaagctgctgtgtggagggggccctgctgctgaccggggctacttcatccagccc
accatctttggggatgtgcaggacaacatgaccatcgcccgggaggagatctttgggccg
gtgatgcagattatgaagttcaagactgttgaagaggtggtagagagagccaatgattcc
aggtatgggctggctgcagcgatcttcacaaaagacctggacaaggccaactatctctcc
caggtgctgcaggctggcacagtgtggataaattgctatgatgtgtttggggcacagtgc
ccatttggaggctacaagatgtctgggaacgggcgagagctgggcgagtatggcctgcag
gcatacacagaagtgaaaactgtcaccatcaaagttcctcagaagaattcctaa

DBGET integrated database retrieval system