KEGG   Phascolarctos cinereus (koala): 110197171
Entry
110197171         CDS       T05867                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw04068  FoxO signaling pathway
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04218  Cellular senescence
pcw04310  Wnt signaling pathway
pcw04340  Hedgehog signaling pathway
pcw04371  Apelin signaling pathway
pcw04390  Hippo signaling pathway
pcw04510  Focal adhesion
pcw04530  Tight junction
pcw04630  JAK-STAT signaling pathway
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05216  Thyroid cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110197171 (CCND1)
   04340 Hedgehog signaling pathway
    110197171 (CCND1)
   04390 Hippo signaling pathway
    110197171 (CCND1)
   04371 Apelin signaling pathway
    110197171 (CCND1)
   04630 JAK-STAT signaling pathway
    110197171 (CCND1)
   04068 FoxO signaling pathway
    110197171 (CCND1)
   04151 PI3K-Akt signaling pathway
    110197171 (CCND1)
   04152 AMPK signaling pathway
    110197171 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110197171 (CCND1)
   04115 p53 signaling pathway
    110197171 (CCND1)
   04218 Cellular senescence
    110197171 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110197171 (CCND1)
   04530 Tight junction
    110197171 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110197171 (CCND1)
   04921 Oxytocin signaling pathway
    110197171 (CCND1)
   04919 Thyroid hormone signaling pathway
    110197171 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110197171 (CCND1)
   05206 MicroRNAs in cancer
    110197171 (CCND1)
   05205 Proteoglycans in cancer
    110197171 (CCND1)
   05203 Viral carcinogenesis
    110197171 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110197171 (CCND1)
   05212 Pancreatic cancer
    110197171 (CCND1)
   05225 Hepatocellular carcinoma
    110197171 (CCND1)
   05226 Gastric cancer
    110197171 (CCND1)
   05214 Glioma
    110197171 (CCND1)
   05216 Thyroid cancer
    110197171 (CCND1)
   05221 Acute myeloid leukemia
    110197171 (CCND1)
   05220 Chronic myeloid leukemia
    110197171 (CCND1)
   05218 Melanoma
    110197171 (CCND1)
   05219 Bladder cancer
    110197171 (CCND1)
   05215 Prostate cancer
    110197171 (CCND1)
   05213 Endometrial cancer
    110197171 (CCND1)
   05224 Breast cancer
    110197171 (CCND1)
   05222 Small cell lung cancer
    110197171 (CCND1)
   05223 Non-small cell lung cancer
    110197171 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110197171 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110197171 (CCND1)
   04934 Cushing syndrome
    110197171 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110197171 (CCND1)
   05162 Measles
    110197171 (CCND1)
   05160 Hepatitis C
    110197171 (CCND1)
   05163 Human cytomegalovirus infection
    110197171 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110197171 (CCND1)
   05169 Epstein-Barr virus infection
    110197171 (CCND1)
   05165 Human papillomavirus infection
    110197171 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110197171 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110197171
NCBI-ProteinID: XP_020826506
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRALQTMLKAEETCSPSVSYFKCVQKDILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDHSVRPEELLHMELLLVNKLKWHLAAMTPHDFIEHFLSKMPVLEENKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGSTNPFLTYQRLTRFLSQVIKCD
PDCLRACQEQIEALLESSLRQAQQHSSSSVPKNMEEEGDLSYTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcaccagctgctgtgctgcgaggtggagaccattcgccgggcgtacctcgatgcc
aacctcctcaacgaccgggcactgcagaccatgctcaaagccgaggagacgtgctcgccc
tccgtctcgtacttcaagtgcgtgcagaaggacatccttccctacatgcgcaagatcgtg
gccacctggatgctcgaggtgtgtgaggagcagaaatgcgaagaggaagtcttccccctg
gccatgaactatctggaccggttcctgtccctggagccgctgaagaagagccggctgcag
ctgctgggggccacctgcatgttcgtggcgtccaagatgaaggagaccatcccactgacg
gccgagaagctgtgtatctacaccgaccactcggtgcggcccgaggagctgctgcacatg
gagctcctcctggtcaacaagctgaaatggcacctggcggccatgaccccccacgacttc
atcgaacactttctgtccaagatgcccgtgctggaggagaacaagcagatcatccgcaaa
cacgcgcagacctttgtggccctctgcgccacagacgtgaagttcatttccaacccccct
tccatgatcgccgcggggagcgtcgtggccgccgtccagggcctgcacttggggagtacc
aaccccttcctcacctaccagcgcctcaccaggttcctgtctcaagttattaagtgtgac
ccggattgcttacgagcctgccaggagcagatcgaagccctcctggagtccagtctgcgc
caggcccagcagcacagctcatcctcagtgcccaagaacatggaggaggagggggacctg
tcctacacgcccaccgacgtgcgagacgtgaacatttga

DBGET integrated database retrieval system