KEGG   Phascolarctos cinereus (koala): 110197417
Entry
110197417         CDS       T05867                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04218  Cellular senescence
pcw04270  Vascular smooth muscle contraction
pcw04370  VEGF signaling pathway
pcw04371  Apelin signaling pathway
pcw04540  Gap junction
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04720  Long-term potentiation
pcw04722  Neurotrophin signaling pathway
pcw04730  Long-term depression
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04912  GnRH signaling pathway
pcw04915  Estrogen signaling pathway
pcw04916  Melanogenesis
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04926  Relaxin signaling pathway
pcw04929  GnRH secretion
pcw04934  Cushing syndrome
pcw04935  Growth hormone synthesis, secretion and action
pcw05010  Alzheimer disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05216  Thyroid cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110197417 (MAP2K2)
   04012 ErbB signaling pathway
    110197417 (MAP2K2)
   04014 Ras signaling pathway
    110197417 (MAP2K2)
   04015 Rap1 signaling pathway
    110197417 (MAP2K2)
   04370 VEGF signaling pathway
    110197417 (MAP2K2)
   04371 Apelin signaling pathway
    110197417 (MAP2K2)
   04066 HIF-1 signaling pathway
    110197417 (MAP2K2)
   04068 FoxO signaling pathway
    110197417 (MAP2K2)
   04072 Phospholipase D signaling pathway
    110197417 (MAP2K2)
   04071 Sphingolipid signaling pathway
    110197417 (MAP2K2)
   04024 cAMP signaling pathway
    110197417 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    110197417 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    110197417 (MAP2K2)
   04150 mTOR signaling pathway
    110197417 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110197417 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    110197417 (MAP2K2)
   04218 Cellular senescence
    110197417 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110197417 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110197417 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110197417 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110197417 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    110197417 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    110197417 (MAP2K2)
   04660 T cell receptor signaling pathway
    110197417 (MAP2K2)
   04662 B cell receptor signaling pathway
    110197417 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    110197417 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110197417 (MAP2K2)
   04929 GnRH secretion
    110197417 (MAP2K2)
   04912 GnRH signaling pathway
    110197417 (MAP2K2)
   04915 Estrogen signaling pathway
    110197417 (MAP2K2)
   04917 Prolactin signaling pathway
    110197417 (MAP2K2)
   04921 Oxytocin signaling pathway
    110197417 (MAP2K2)
   04926 Relaxin signaling pathway
    110197417 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    110197417 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    110197417 (MAP2K2)
   04916 Melanogenesis
    110197417 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110197417 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    110197417 (MAP2K2)
   04730 Long-term depression
    110197417 (MAP2K2)
   04722 Neurotrophin signaling pathway
    110197417 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110197417 (MAP2K2)
   05206 MicroRNAs in cancer
    110197417 (MAP2K2)
   05205 Proteoglycans in cancer
    110197417 (MAP2K2)
   05230 Central carbon metabolism in cancer
    110197417 (MAP2K2)
   05231 Choline metabolism in cancer
    110197417 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110197417 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110197417 (MAP2K2)
   05225 Hepatocellular carcinoma
    110197417 (MAP2K2)
   05226 Gastric cancer
    110197417 (MAP2K2)
   05214 Glioma
    110197417 (MAP2K2)
   05216 Thyroid cancer
    110197417 (MAP2K2)
   05221 Acute myeloid leukemia
    110197417 (MAP2K2)
   05220 Chronic myeloid leukemia
    110197417 (MAP2K2)
   05218 Melanoma
    110197417 (MAP2K2)
   05211 Renal cell carcinoma
    110197417 (MAP2K2)
   05219 Bladder cancer
    110197417 (MAP2K2)
   05215 Prostate cancer
    110197417 (MAP2K2)
   05213 Endometrial cancer
    110197417 (MAP2K2)
   05224 Breast cancer
    110197417 (MAP2K2)
   05223 Non-small cell lung cancer
    110197417 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110197417 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    110197417 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110197417 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110197417 (MAP2K2)
   05135 Yersinia infection
    110197417 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110197417 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    110197417 (MAP2K2)
   05161 Hepatitis B
    110197417 (MAP2K2)
   05160 Hepatitis C
    110197417 (MAP2K2)
   05164 Influenza A
    110197417 (MAP2K2)
   05163 Human cytomegalovirus infection
    110197417 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110197417 (MAP2K2)
   05165 Human papillomavirus infection
    110197417 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110197417 (MAP2K2)
   01522 Endocrine resistance
    110197417 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110197417 (MAP2K2)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110197417 (MAP2K2)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: STE group
  STE7 family
   110197417 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Kdo APH Seadorna_VP7
Other DBs
NCBI-GeneID: 110197417
NCBI-ProteinID: XP_020826984
UniProt: A0A6P5J7I0
LinkDB
Position
Unknown
AA seq 400 aa
MLAKRKPVLPALNITPTIAEGPSPTSEGASEANLADLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNTRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDSKELEAIFGRPMVEGAEGEPHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAM
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggccaagaggaagccggtgctgccggcgctcaacatcaccccgaccatcgccgag
ggcccgtccccgaccagcgagggcgcgtccgaggcgaacctggcagatctgcagaaaaaa
ttagaagagctagaacttgatgagcagcagaagaagcggctggaagctttcctcacccag
aaggcaaaggtgggggagctgaaggatgatgactttgagaggatctccgagctgggagct
ggcaatggcggggtggtcaccaaagtacagcatagaccttcagggctcatcatggcccga
aagttgattcacctagagatcaaaccagcaatccggaaccagattatccgtgaactccaa
gtcctacatgaatgcaactctccatacatcgtgggtttctatggtgccttttatagcgac
ggagagatcagcatctgcatggagcacatggatggaggctctctggatcaagtattgaaa
gaggccaagagaattcctgaagaaatcttggggaaagttagcattgcggttcttcggggt
ttggcttatctaagagagaaacaccagattatgcacagagatgtgaaaccttctaatatt
ttggtcaacactcggggagagatcaagctctgtgacttcggagtgagtgggcaactcatc
gactctatggcaaattcctttgtaggaacccgatcctacatgtctccggagcggttacaa
ggcacccactactcagtccagtcagatatctggagcatgggcctgtccctagtagagctg
tccattggacggtatccgattcccccaccagactccaaggaactagaagcgatatttggt
cggcccatggtcgaaggggcagagggagaacctcacagcatctcgccacggccacgaccc
ccaggacgccccatcagtggtcatgggatggacagtcggcctgccatggccatctttgag
ctattggactatattgttaacgagcctccacctaagttgccgaatggtgttttcacacaa
gatttccaggagtttgtaaataaatgcttaattaaaaacccagccgagagggcagatctg
aagatgctgatgaatcacacttttatcaagcggtcagaagtggaagaagtggattttgca
ggctggttatgtaaaactctgaggttaaaccagcccagtactcccacacgcactgccatg
tga

KEGG   Phascolarctos cinereus (koala): 110205943
Entry
110205943         CDS       T05867                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04114  Oocyte meiosis
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04218  Cellular senescence
pcw04270  Vascular smooth muscle contraction
pcw04370  VEGF signaling pathway
pcw04371  Apelin signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04540  Gap junction
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04668  TNF signaling pathway
pcw04720  Long-term potentiation
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04726  Serotonergic synapse
pcw04730  Long-term depression
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04912  GnRH signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04916  Melanogenesis
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04926  Relaxin signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04929  GnRH secretion
pcw04934  Cushing syndrome
pcw04935  Growth hormone synthesis, secretion and action
pcw05010  Alzheimer disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05034  Alcoholism
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05216  Thyroid cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110205943 (MAP2K1)
   04012 ErbB signaling pathway
    110205943 (MAP2K1)
   04014 Ras signaling pathway
    110205943 (MAP2K1)
   04015 Rap1 signaling pathway
    110205943 (MAP2K1)
   04370 VEGF signaling pathway
    110205943 (MAP2K1)
   04371 Apelin signaling pathway
    110205943 (MAP2K1)
   04668 TNF signaling pathway
    110205943 (MAP2K1)
   04066 HIF-1 signaling pathway
    110205943 (MAP2K1)
   04068 FoxO signaling pathway
    110205943 (MAP2K1)
   04072 Phospholipase D signaling pathway
    110205943 (MAP2K1)
   04071 Sphingolipid signaling pathway
    110205943 (MAP2K1)
   04024 cAMP signaling pathway
    110205943 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    110205943 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    110205943 (MAP2K1)
   04150 mTOR signaling pathway
    110205943 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110205943 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110205943 (MAP2K1)
   04210 Apoptosis
    110205943 (MAP2K1)
   04218 Cellular senescence
    110205943 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110205943 (MAP2K1)
   04540 Gap junction
    110205943 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110205943 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110205943 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110205943 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    110205943 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    110205943 (MAP2K1)
   04660 T cell receptor signaling pathway
    110205943 (MAP2K1)
   04662 B cell receptor signaling pathway
    110205943 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    110205943 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    110205943 (MAP2K1)
   04062 Chemokine signaling pathway
    110205943 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110205943 (MAP2K1)
   04929 GnRH secretion
    110205943 (MAP2K1)
   04912 GnRH signaling pathway
    110205943 (MAP2K1)
   04915 Estrogen signaling pathway
    110205943 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    110205943 (MAP2K1)
   04917 Prolactin signaling pathway
    110205943 (MAP2K1)
   04921 Oxytocin signaling pathway
    110205943 (MAP2K1)
   04926 Relaxin signaling pathway
    110205943 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    110205943 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    110205943 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    110205943 (MAP2K1)
   04916 Melanogenesis
    110205943 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110205943 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    110205943 (MAP2K1)
   04726 Serotonergic synapse
    110205943 (MAP2K1)
   04720 Long-term potentiation
    110205943 (MAP2K1)
   04730 Long-term depression
    110205943 (MAP2K1)
   04722 Neurotrophin signaling pathway
    110205943 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110205943 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110205943 (MAP2K1)
   05206 MicroRNAs in cancer
    110205943 (MAP2K1)
   05205 Proteoglycans in cancer
    110205943 (MAP2K1)
   05230 Central carbon metabolism in cancer
    110205943 (MAP2K1)
   05231 Choline metabolism in cancer
    110205943 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110205943 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110205943 (MAP2K1)
   05212 Pancreatic cancer
    110205943 (MAP2K1)
   05225 Hepatocellular carcinoma
    110205943 (MAP2K1)
   05226 Gastric cancer
    110205943 (MAP2K1)
   05214 Glioma
    110205943 (MAP2K1)
   05216 Thyroid cancer
    110205943 (MAP2K1)
   05221 Acute myeloid leukemia
    110205943 (MAP2K1)
   05220 Chronic myeloid leukemia
    110205943 (MAP2K1)
   05218 Melanoma
    110205943 (MAP2K1)
   05211 Renal cell carcinoma
    110205943 (MAP2K1)
   05219 Bladder cancer
    110205943 (MAP2K1)
   05215 Prostate cancer
    110205943 (MAP2K1)
   05213 Endometrial cancer
    110205943 (MAP2K1)
   05224 Breast cancer
    110205943 (MAP2K1)
   05223 Non-small cell lung cancer
    110205943 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110205943 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    110205943 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    110205943 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110205943 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110205943 (MAP2K1)
   05135 Yersinia infection
    110205943 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110205943 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    110205943 (MAP2K1)
   05161 Hepatitis B
    110205943 (MAP2K1)
   05160 Hepatitis C
    110205943 (MAP2K1)
   05164 Influenza A
    110205943 (MAP2K1)
   05163 Human cytomegalovirus infection
    110205943 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110205943 (MAP2K1)
   05165 Human papillomavirus infection
    110205943 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110205943 (MAP2K1)
   01522 Endocrine resistance
    110205943 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110205943 (MAP2K1)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110205943 (MAP2K1)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: STE group
  STE7 family
   110205943 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 Kinase-like
Other DBs
NCBI-GeneID: 110205943
NCBI-ProteinID: XP_020838600
UniProt: A0A6P5K0H0
LinkDB
Position
Unknown
AA seq 393 aa
MPKKKPGPIQLNPTPDGSTINGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDSKELELMFGCPMEGDAPETSPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcctaagaagaagccagggcccattcagctgaacccgaccccggatggctccacgatt
aacgggaccagctcggccgagactaacctcgaggcgctgcagaagaagctggaggaatta
gaacttgatgaacagcaacgcaagcgactggaggcttttctcacccagaaacagaaagtg
ggcgagctgaaagatgatgacttcgagaagatcagtgaactaggagctgggaatggtggt
gtcgtgtttaaagtttcccacaagccctctggcctaatcatggcaaggaagctaattcac
ctggagatcaagccagcaattcggaaccagattatacgggagctgcaagtcctgcacgag
tgcaactctccatatattgtagggttttatggtgccttttacagcgatggggagatcagt
atctgcatggagcacatggatggaggatctttggaccaggttcttaagaaggctggaaga
attcctgagcagatattggggaaagttagcattgctgtaataaagggtcttacatatctg
agggagaagcataagataatgcacagagacgtcaagccatccaacatcttggtgaactca
cgaggggaaatcaaactttgtgactttggcgtcagtgggcagctgattgattccatggct
aactctttcgtgggcacaaggtcctatatgtcgccagaaagactccagggaactcactac
tcagtacagtcagacatctggagcatgggactttctttggtggagatggcaattggacga
tatcccattccaccgccagattccaaggagctagaactgatgtttggctgtccaatggag
ggagatgctcctgagacgtcaccaaggccaagaactcctgggaggcctttaagctcttat
ggaatggatagccgaccacctatggcaatttttgagctgctggattacatagtcaatgag
cctcctccaaagttgcccagtggagtctttagtctggaatttcaagattttgtgaataaa
tgcctaataaaaaacccagcagagagagctgatttgaagcaacttatggttcatgctttt
atcaagaggtctgatgccgaggaagttgattttgcaggctggctgtgctccaccataggc
cttaaccagcctagcacaccaactcatgctgctggcgtctaa

DBGET integrated database retrieval system