KEGG   Phascolarctos cinereus (koala): 110198372
Entry
110198372         CDS       T05867                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04217  Necroptosis
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04630  JAK-STAT signaling pathway
pcw04659  Th17 cell differentiation
pcw04917  Prolactin signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04931  Insulin resistance
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw05145  Toxoplasmosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05212  Pancreatic cancer
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110198372 (STAT3)
   04066 HIF-1 signaling pathway
    110198372 (STAT3)
   04068 FoxO signaling pathway
    110198372 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110198372 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110198372 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110198372 (STAT3)
   04062 Chemokine signaling pathway
    110198372 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110198372 (STAT3)
   04917 Prolactin signaling pathway
    110198372 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    110198372 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110198372 (STAT3)
   05206 MicroRNAs in cancer
    110198372 (STAT3)
   05205 Proteoglycans in cancer
    110198372 (STAT3)
   05203 Viral carcinogenesis
    110198372 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110198372 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110198372 (STAT3)
   05221 Acute myeloid leukemia
    110198372 (STAT3)
   05223 Non-small cell lung cancer
    110198372 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110198372 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110198372 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110198372 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    110198372 (STAT3)
   05161 Hepatitis B
    110198372 (STAT3)
   05160 Hepatitis C
    110198372 (STAT3)
   05163 Human cytomegalovirus infection
    110198372 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110198372 (STAT3)
   05169 Epstein-Barr virus infection
    110198372 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110198372 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110198372 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110198372 (STAT3)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    110198372 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 DUF4795 AP1AR Baculo_PEP_C Syntaxin-6_N Fib_alpha
Other DBs
NCBI-GeneID: 110198372
NCBI-ProteinID: XP_020828248
LinkDB
Position
Unknown
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NLLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSSGGGQFETLTFDMDLTSECATSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcacaatggaaccagctgcagcagcttgacacacggtacctggaacaacttcaccag
ttgtatagtgacagctttcccatggagcttcggcaatttctggctccctggatagagagc
caggactgggcatatgctgccagtaaagagtcacatgccaccttggtcttccacaacctc
ttgggtgagattgaccagcagtacagccgcttccttcaggagtcaaatgtcctctatcaa
cacaacttgcggagaatcaagcagttcctgcagagcagatatcttgaaaagccaatggag
attgccaggatcgtggctcggtgcctgtgggaggagtctcgtctccttcagacagcagct
acagctgcccagcaaggagggcaagccaaccaccccacagctgctgtggtgacagaaaaa
cagcagatgctagagcagcacttgcaggatgtgaggaaaagagtacaggatctggaacag
aagatgaaagtggtggagaatctccaggatgactttgatttcaactacaagacactaaaa
agtcaaggagacatgcaagatctaaatggaaataatcagtcggtcactaggcaaaaaatg
cagcagctggagcagatgctgactgccctcgaccagatgcgaaggggaatcgtgagtgaa
ttagcagggcttctttcagccatggagtatgtgcagaagactctcacagatgaggaacta
gcagactggaagaggagacaacagattgcttgtattggaggtcctcccaacatctgcctg
gatcgcctagaaaactggataacttccttagccgaatctcagctccagacccgtcagcag
ataaagaagctggaggaattacagcagaaagtctcctacaaaggtgaccccatcgtccaa
caccgacctatgctggaagagagaattgtggagctctttaggaatttaatgaaaagtgcc
tttgttgtagagcggcagccctgcatgcctatgcaccctgatcggcccttggtcatcaag
acaggtgttcagttcactaccaaagtcaggttattggtcaaatttcctgaattaaactat
caacttaaaattaaagtgtgcattgacaaagactctggtgatgtcgcggcattaagagga
tctcggaaattcaacattctggggacaaacacgaaagtgatgaacatggaggagtctaac
aacggcagcctgtctgcagagttcaaacacttgaccctgagggagcagagatgtggcaat
gggggccgggccaactgtgatgcctctctgatagtgactgaagaacttcatctcatcact
tttgagacagaagtctaccatcaaggcctaaagatcgacttggagacacactccttacca
gtggtggtgatctctaacatctgtcagatgccaaatgcctgggcttcgatcctgtggtat
aacctgttgaccaacaaccccaagaacgttaacttcttcaccaaacctcctattgggaca
tgggatcaagttgccgaggtgctaagctggcagttttcctccaccacgaagcgtggcttg
agcattgagcagttgaccacactcgcagagaagcttttaggacctggtgtgaattactca
gggtgccagatcacatgggccaaattttgcaaagaaaacatggctggaaaaggtttctcc
ttctgggtttggttggacaacattattgacctcgtgaaaaagtacattttggcattgtgg
aatgaagggtacataatgggcttcattagcaaggaacgagagagagccatcctgagcacg
aaaccccctggaaccttcctgttgaggttcagtgagagcagcaaagagggaggcatcacc
ttcacctgggtggagaaggatattagtggcaagacccagatccaatcagtggaaccatac
acaaagcagcagctgaacaatatgtcctttgctgagatcatcatgggctataaaatcatg
gatgccaccaacatcctggtgtctccccttgtctatctctaccctgacattcccaaggag
gaggcatttggaaagtattgccggccagagagccaggagcatcctgaagctgacccaggt
agtgctgccccatatctgaagaccaagtttatctgtgtgactccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggagctgagccctcatcaggagggggacagtttgagaccctcacgtttgacatg
gacttgacttctgagtgtgctacatcccccatgtga

DBGET integrated database retrieval system