KEGG   Phascolarctos cinereus (koala): 110198716
Entry
110198716         CDS       T05867                                 

Gene name
ZBTB17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17 isoform X1
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04110  Cell cycle
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110198716 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110198716 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    110198716 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110198716 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110198716 (ZBTB17)
   04121 Ubiquitin system [BR:pcw04121]
    110198716 (ZBTB17)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    110198716 (ZBTB17)
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110198716 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-C2H2_6 zf-H2C2_5 zf-C2HC_2 Zn-ribbon_8 zf-BED zf-Di19 zinc_ribbon_15 zf-C2HE zf_UBZ XPA_N zf-C2H2_2
Other DBs
NCBI-GeneID: 110198716
NCBI-ProteinID: XP_020828803
UniProt: A0A6P5J618
LinkDB
Position
Unknown
AA seq 816 aa
MAAMDFPQHSQLVLEQLNQQRQLGLLCDCTFVVDGINFKAHKAVLAACSEYFKMLFVDQK
DVVHLDISNAAGLGQVLEFMYTAKLSLSPENVEDVLAVAGFLQMQDIVSACNALKSLPVE
TSSTLEKLKPPEPEGEEKKAEEEKKAAATTLSELDRVEYDPLARPSEETNGEPEPQAESR
GDGLGAEGKRDAKSEEPLPTETSPSSVGPALEVLLSQRTQQEGEIETQRSEVTHPSGPAE
IEAEPVREDEEQKDKSPEGAALGEVSPAEENRPQLENGEAAEENEESGGTDSGQENVGEA
RVLRSGTYSDRTESKAYGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECNKAFS
DPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHTGEARYRCDDCGKLFTTSGN
LKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAH
LKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCVHCQRQFADPGALQRHVRIH
TGEKPCQCLICGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIR
PHKCSVCSKAFVNVGDLSKHIIIHTGEKPFLCDKCGRGFNRVDNLRSHVKTVHQGKAGIK
IVEPDEGDEVNIVTVASDDMVTLATEALAATAVTQLTVVPVGAAVTADETEALKAEITKA
VKQVQEADPNTQILYACDSCGEKFLDANSLAQHVRIHTAQALVMFQADTDFYQQYGPGST
WPAEQVLQAGELLFRPREGTEGQTVLAEPPPPTVAE
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggcagccatggatttcccgcagcatagccagctggtcctggagcagttgaatcagcag
cggcagttgggcctgctgtgtgactgcacctttgtggtggacggaatcaactttaaggcc
cacaaggctgtgctggcggcttgcagtgagtacttcaagatgctctttgtggaccaaaag
gacgtggtgcatctggacatcagtaatgcggcaggtctggggcaggtgctagagttcatg
tacacggccaagctgagcctaagccctgagaacgtggaggatgtgctggctgtggcaggc
ttcctccagatgcaggacattgtcagcgcatgcaatgccctcaaatcccttcctgtggaa
acctccagcacgttggagaaactaaaaccgcctgagcccgagggggaggaaaagaaagct
gaggaggagaaaaaggccgctgccaccaccctcagcgagctggaccgagtggagtatgac
cctctagcgagacccagtgaggaaaccaatggcgagccagagccccaagctgagagcaga
ggggatggactcggtgcagaggggaagagggacgccaaatctgaggagccgctgcctacc
gaaaccagccccagctctgtgggtccagcccttgaggtactcctgtcacagagaacacag
caagagggggaaatagagacgcagaggagtgaagtgactcacccaagtggcccagcagaa
atcgaggctgagccagtgagggaggatgaggaacagaaggacaagagcccagaaggagca
gccttaggggaagtcagcccagctgaggagaacaggcctcagctggagaacggagaagcc
gccgaggagaacgaggagtctggaggcaccgactctgggcaggagaacgtgggggaggcc
cgggtcttacgctcaggcacctatagcgaccgcaccgagtccaaggcttacggttctgtc
atccacaagtgtgaggattgtgggaaggagttcactcacacaggcaacttcaagcggcac
atccgcatccacactggagagaagcccttctcgtgccgggagtgtaacaaggccttttct
gaccccgcggcctgcaaggcccatgagaaaacgcacagccccctgaagccatacggctgc
gaggagtgcggcaagagctaccggctcatcagcctgctgaacctgcacaagaagcggcac
acgggggaggcccgctaccgctgcgatgactgcggcaagctcttcaccacctcgggcaac
ctgaagcgccaccagctggtgcacagcggcgagaagccctaccagtgtgactactgcggg
cgctccttctccgaccccacctccaagatgcgccacctggagacccacgacactgacaag
gagcacaagtgcccccactgcgacaagaagttcaaccaggtgggcaacctgaaagcgcat
ctaaagatacatattgcggatggacccctgaagtgcagggagtgtggcaagcaattcacc
acctcaggaaacctgaagcggcaccttcgaatccacagtggggagaagccttatgtctgc
gtccactgtcagaggcagtttgcagaccccggtgccctgcagaggcacgttcgcatccac
acgggagagaagccgtgtcagtgcctcatctgtggaaaggctttcacccaggccagctcc
ctcattgcccacgtgcgccagcacaccggcgagaagccctacgtctgtgagcgctgcggc
aaaaggtttgtccagtctagccagctggccaaccacatccgccaccatgacaacatccgc
ccgcacaagtgcagcgtgtgcagcaaggcctttgtcaacgtgggggatctgtccaagcac
atcatcatccacaccggggaaaaacccttcctctgtgacaagtgtggacgtggcttcaac
cgcgtggacaaccttcgctcccacgtgaagacggtgcaccagggcaaggcaggcatcaag
atcgtagagccggacgagggggatgaggtcaacattgtgaccgtcgcctcagacgacatg
gtcaccctggccaccgaggcactggctgccacggccgtcacccagcttacagtggtgcct
gtcggggccgcagtgacggcggatgagacggaagccctcaaagctgagatcaccaaagct
gtgaagcaggtgcaggaagcagacccaaacacccagatcctctatgcctgtgattcatgt
ggtgagaagttcctggatgccaacagcctagctcagcatgtccggatccacacagcccag
gccctggtcatgtttcaggcagatacggacttctaccagcagtacggcccaggcagcacg
tggccggcagagcaggtgttgcaggccggggaactgcttttccgcccccgggaagggact
gagggccagactgtgctggcagagccccctccacccactgtggccgaatga

DBGET integrated database retrieval system