KEGG   Phascolarctos cinereus (koala): 110198824
Entry
110198824         CDS       T05867                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04115  p53 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04370  VEGF signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05134  Legionellosis
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05215  Prostate cancer
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110198824 (CASP9)
   04151 PI3K-Akt signaling pathway
    110198824 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110198824 (CASP9)
   04215 Apoptosis - multiple species
    110198824 (CASP9)
   04115 p53 signaling pathway
    110198824 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110198824 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110198824 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110198824 (CASP9)
   05212 Pancreatic cancer
    110198824 (CASP9)
   05215 Prostate cancer
    110198824 (CASP9)
   05213 Endometrial cancer
    110198824 (CASP9)
   05222 Small cell lung cancer
    110198824 (CASP9)
   05223 Non-small cell lung cancer
    110198824 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110198824 (CASP9)
   05012 Parkinson disease
    110198824 (CASP9)
   05014 Amyotrophic lateral sclerosis
    110198824 (CASP9)
   05016 Huntington disease
    110198824 (CASP9)
   05020 Prion disease
    110198824 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    110198824 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110198824 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110198824 (CASP9)
   05152 Tuberculosis
    110198824 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110198824 (CASP9)
   05161 Hepatitis B
    110198824 (CASP9)
   05160 Hepatitis C
    110198824 (CASP9)
   05164 Influenza A
    110198824 (CASP9)
   05162 Measles
    110198824 (CASP9)
   05168 Herpes simplex virus 1 infection
    110198824 (CASP9)
   05163 Human cytomegalovirus infection
    110198824 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110198824 (CASP9)
   05169 Epstein-Barr virus infection
    110198824 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110198824 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110198824 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110198824 (CASP9)
   01002 Peptidases and inhibitors [BR:pcw01002]
    110198824 (CASP9)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     110198824 (CASP9)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110198824 (CASP9)
Peptidases and inhibitors [BR:pcw01002]
 Cysteine peptidases
  Family C14: caspase family
   110198824 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 110198824
NCBI-ProteinID: XP_020828983
UniProt: A0A6P5J6I5
LinkDB
Position
Unknown
AA seq 429 aa
MEEAQRELLQQNRLRLVRELRVEPLWDLMLAQELFTRDMIEDIQAGTRRDQARQLITDLQ
TRGKRALPIFISCLEDTGQWALATLLRESNSTQQLDPIDIKPIEMVRSGESSSTCMKLPT
RSLVPGSHTSKEEDPEASYLDVAQGAAGPVQARCWRNFGVVGQVYTLNSDPCGYCLIINN
VDFHASSGLSVRTGSNIDCEKMQKRFQALYFAVEVKCNLSAQAMGAALQQLAKRDHSALD
CCVVVILSHGCQASHIQFPGAIYGVDGASISVETIVNIFSGSRCPSLGGKPKLFFIQACG
GDQRDHGFQVSSNTPEDESPGSDPDSDPETDATPFQNNFDQPDAVASLPTPSDILVSYST
FPGFVSWRDIKSGSWYIETLDRMLDMWADDEDLLSILLMVSNAVSAKGTYKQIPGCFNFL
RKRFFFKTK
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggaggaggctcagcgggagctcttgcagcagaaccgcttgcgcctggtgagggagctg
cgggtagagccgctctgggatctgatgctggcccaggagctgttcactcgcgacatgatc
gaggacatacaggctggtactcggagagaccaggctaggcagttgataacagatcttcag
acacgagggaagcgtgcccttcccatattcatctcttgcctggaagataccggccaatgg
gctctggcaactctcctccgtgaaagtaattcaacccagcaactggacccaattgacatc
aaaccaattgaaatggtcagatctggagaatccagcagtacttgtatgaagcttcccacg
agatcactggtcccaggctcccacaccagcaaggaagaagacccagaggcatcatacttg
gatgtagcgcagggtgctgcggggcctgtacaagccagatgttggagaaactttggtgtg
gttggacaggtgtatactctgaactcagacccatgtggctactgccttatcatcaacaat
gtggacttccatgcttcctcaggcctttctgtccgaacaggctcgaacattgactgtgaa
aagatgcagaaacgctttcaagcgctgtattttgctgtggaggtcaagtgtaatctgagc
gcgcaggcaatgggagcagccttgcagcagctggccaagagggaccacagtgccctggac
tgctgcgtggtggtcattctgtctcatggctgtcaggccagtcatatccagtttccagga
gccatctatggcgtagacggagcctccatttcagttgagacaattgtgaacatcttcagt
gggtccagatgccccagcctgggagggaaacccaagcttttcttcatccaggcctgtggt
ggggatcagagagaccatggatttcaggtgtcttctaatactcctgaggatgagtcccct
ggcagtgaccctgacagtgaccctgagacagatgctacccctttccaaaataactttgat
caaccagatgctgtggccagcctaccgacacctagtgatatcttggtgtcctattctaca
tttcctggttttgtctcctggagggatatcaagagtggttcatggtacatagagaccttg
gatagaatgttggacatgtgggcagatgacgaagacttactgagcattcttctcatggtg
tctaatgcagtgtctgccaaagggacatacaaacagattcctggttgctttaatttcctc
cggaaaagatttttctttaaaaccaagtga

DBGET integrated database retrieval system