KEGG   Phascolarctos cinereus (koala): 110199336
Entry
110199336         CDS       T05867                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw03320  PPAR signaling pathway
pcw04659  Th17 cell differentiation
pcw04919  Thyroid hormone signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05216  Thyroid cancer
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110199336 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110199336 (RXRB)
   03320 PPAR signaling pathway
    110199336 (RXRB)
   04919 Thyroid hormone signaling pathway
    110199336 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    110199336 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110199336 (RXRB)
   05202 Transcriptional misregulation in cancer
    110199336 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    110199336 (RXRB)
   05216 Thyroid cancer
    110199336 (RXRB)
   05222 Small cell lung cancer
    110199336 (RXRB)
   05223 Non-small cell lung cancer
    110199336 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110199336 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcw03310]
    110199336 (RXRB)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110199336 (RXRB)
Nuclear receptors [BR:pcw03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110199336 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 110199336
NCBI-ProteinID: XP_020829789
UniProt: A0A6P5JFE6
LinkDB
Position
Unknown
AA seq 462 aa
MGDSGRDCRSPDSSSLSSSPQPPSRGGPPPSPPGPPLAPLPSAASSLLGTGGPPQLPLGS
PFPVISSSMGSPGLPPPAPPGPYGPVSSPQINSTVSLPGGGSGPPEDVKPPLLGVRGLHC
PPPPSGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDK
RQRNRCQYCRYQKCLATGMKREAVQEERQRGKEKDGEGEGAGGAPEEMPVDRILEAELAV
EQKSDQGVEGPGGAGGGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVIL
LRAGWNELLIASFSHRSISVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
RMDKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLESYCKQKYPEQQGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggcgacagcgggcgggactgtagaagcccagacagctcctccctgagctcatcccca
caacccccttcccgggggggccctcccccttctcctcctgggccccccctggctccccta
ccctctgcagcttcatccctcctaggaacaggaggcccaccccaactcccgcttggctcc
cccttccctgtcatcagctcctccatggggtcacctgggctgcctcccccagcccctcct
ggaccctatggccctgtcagcagtccccagattaactccacagtgtcactccctggggga
gggtccggccccccagaagatgtgaagccaccactgttgggtgttcgaggcctgcactgc
ccacctcccccatcaggtccaggggctggcaaacgtctttgtgcaatctgtggggacagg
agttcaggcaaacactatggggtctacagctgtgaaggttgtaaaggtttcttcaagcga
accatccgaaaggacctgacgtactcatgtcgggacaacaaggactgcactgtggacaag
aggcaacggaaccgctgtcagtactgccgctaccagaaatgccttgccaccggcatgaag
agggaggcggtacaggaggagcgtcaaaggggcaaggagaaggacggggaaggggagggg
gccgggggggcccctgaggagatgcctgtggacaggatcctggaggctgaactcgccgtg
gagcagaagagtgaccagggcgtagaagggcccgggggggccgggggcggcggcagtagc
ccaaatgaccctgtgaccaacatctgtcaggcagcagacaagcagctctttacactggtt
gagtgggcaaagaggatcccgcacttctcctctctgcctttggatgaccaggtcatcctg
ctccgagcaggctggaatgagctcctcatcgcctccttctcccatcgttccatctccgtc
agggatggcatcctccttgccacagggctccatgtccatcgaaactctgctcattcagct
ggtgttggagccatttttgaccgggtgctgactgaactggtgtccaaaatgcgtgatatg
cgaatggacaagacagaacttggctgtctgagggcaattatcttattcaacccagatgcc
aagggcctctccaaccctggggaggtagagattctgagggagaaagtctatgcatctctg
gagtcatactgtaaacagaaataccctgagcagcagggacggttcgcaaagctgctcctt
cgtctccctgccctccgatctattggcctcaagtgcttggagcatctgtttttcttcaag
ctcatcggggatacacccatcgacacctttctcatggagatgctagaggcaccacaccag
cttgcctaa

KEGG   Phascolarctos cinereus (koala): 110205364
Entry
110205364         CDS       T05867                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw03320  PPAR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04659  Th17 cell differentiation
pcw04919  Thyroid hormone signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04932  Non-alcoholic fatty liver disease
pcw04976  Bile secretion
pcw05160  Hepatitis C
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05216  Thyroid cancer
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110205364 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110205364 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110205364 (RXRA)
   03320 PPAR signaling pathway
    110205364 (RXRA)
   04919 Thyroid hormone signaling pathway
    110205364 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    110205364 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    110205364 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110205364 (RXRA)
   05202 Transcriptional misregulation in cancer
    110205364 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    110205364 (RXRA)
   05216 Thyroid cancer
    110205364 (RXRA)
   05222 Small cell lung cancer
    110205364 (RXRA)
   05223 Non-small cell lung cancer
    110205364 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110205364 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110205364 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110205364 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcw03310]
    110205364 (RXRA)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110205364 (RXRA)
Nuclear receptors [BR:pcw03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110205364 (RXRA)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 110205364
NCBI-ProteinID: XP_020837579
UniProt: A0A6P5JYJ0
LinkDB
Position
Unknown
AA seq 483 aa
MRLHLLTSISGGALPWFGGDRRRLADFSTQVNPTSLNSPTGRGSMAAPSLHPSIGPGLGS
SLGSSSQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMN
PVSSTEDIKPPLGLNGVLKVPAHPSGTMASFTKHICAICGDRSSGKHYGVYSCEGCKGFF
KRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENE
VESTSSANEDMPVEKILEAELAVEPKTETYIEANMGLNPNSPNDPVTNICQAADKQLFTL
VEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHS
AGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYAS
LEAYCKHKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPH
QMT
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaggctgcacctgctcacctctatttctggaggggccttgccctggtttgggggggac
cggagaaggctggcagatttttccacccaggtcaatcccacatccctgaattcgcccact
ggcagagggtccatggctgcaccctccctgcacccgtccattggcccaggccttggctca
tcgctcggctcgtccagccagctgcactcacccatcagcaccctcagctcccccatcaat
ggcatgggccctcccttctctgtcatcagctcccccatggggcctcactcaatgtctgtc
cccacaactcccacccttgggtttgggacgggcagccctcagctcaattcgccaatgaac
cctgtcagcagcacagaagatattaagccaccccttgggctcaatggagttcttaaagtg
cccgcccatccctcaggaactatggcctccttcaccaagcacatatgtgccatctgtggg
gaccgctcctcaggtaaacattacggtgtgtacagttgtgaaggctgtaaaggcttcttc
aagaggacagtccgcaaggacctcacctatacctgccgagacaataaagactgcctgatt
gacaaacgccagcggaaccggtgccaatactgccgctaccagaagtgtcttgccatgggc
atgaagcgagaagctgtgcaagaggagaggcagaggggcaaagatcggaatgagaacgag
gtggagtcaaccagcagcgctaacgaggacatgccggtggaaaagattttggaagctgaa
cttgccgtggagccaaagacagagacatacattgaggcaaacatgggactaaatcccaat
tcacccaacgaccctgttacgaacatatgccaagcagcagacaaacagctcttcaccttg
gtggaatgggccaagagaatcccccacttctcagagctgcctctggatgaccaggtcatt
ctgttgcgagcaggctggaatgagctgctcatcgcctcgttctctcaccgctcgatagca
gtgaaagatgggatccttcttgccaccggccttcacgtccataggaacagcgctcacagt
gcaggggtgggcgccatctttgacagagtcctgacagaacttgtgtcaaaaatgcgagac
atgcagatggacaagacagagctgggctgcctgagagccattgtcctcttcaatccggac
tctaagggactttccaaccctgcagaagtagaagccctgcgagagaaagtttacgcttcc
cttgaagcctactgcaaacacaagtatccggaccagcctggaaggtttgccaagctcttg
ctccgtctccctgctctccggtccattggcctgaaatgcttggagcacctcttcttcttc
aagctaataggagatacacccattgacaccttcctgatggagatgttggaggccccgcac
caaatgacatag

KEGG   Phascolarctos cinereus (koala): 110209882
Entry
110209882         CDS       T05867                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw03320  PPAR signaling pathway
pcw04659  Th17 cell differentiation
pcw04919  Thyroid hormone signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05216  Thyroid cancer
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110209882 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110209882 (RXRG)
   03320 PPAR signaling pathway
    110209882 (RXRG)
   04919 Thyroid hormone signaling pathway
    110209882 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    110209882 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110209882 (RXRG)
   05202 Transcriptional misregulation in cancer
    110209882 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    110209882 (RXRG)
   05216 Thyroid cancer
    110209882 (RXRG)
   05222 Small cell lung cancer
    110209882 (RXRG)
   05223 Non-small cell lung cancer
    110209882 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110209882 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcw03310]
    110209882 (RXRG)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110209882 (RXRG)
Nuclear receptors [BR:pcw03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110209882 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 110209882
NCBI-ProteinID: XP_020844255
UniProt: A0A6P5KFA9
LinkDB
Position
Unknown
AA seq 467 aa
MYGNYSHFMKFPAGFGSSLSHTNSPSMSPSPALTTGKSTESHSTYIEAPVSIPRTLASPL
SAVGSPLNALGSSYRVITSAIGPHSLSLATSPGVNMVGPPNSQLNVANNVRSSDDVKPLP
GLQGMGTMSYPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCR
DNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAENEVESTSSGHEDMPV
ERILEAELAVEPKTESYGDTNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLE
DQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVS
KMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVEALREKVYATLEAYTKQKYPDQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtatggaaattactctcacttcatgaagtttcctgcaggctttggtagttctctcagt
cacactaactccccgtctatgagcccatcgccagccctgaccacaggaaaatccacggag
agccactccacctacatcgaggccccagtcagtattccaaggacacttgcctccccactg
agcgccgttgggtctcctttgaatgctctgggctcttcataccgagtcattacatcagcc
ataggacctcactccttatccctggccacctctccaggtgtcaacatggttggtccaccc
aattctcagctcaatgttgcaaacaatgtcagaagctcggatgatgtcaagcccttgcca
ggacttcaaggaatgggaaccatgagctacccatccactagcccgggatcccttgccaaa
cacatctgtgccatctgtggagacagatcctcagggaagcactatggggtatacagttgt
gaaggttgtaaagggttcttcaagaggaccataaggaaagacctcatctatacatgccgg
gataacaaggactgcctcattgataagcgccaacggaaccgctgccaatactgccgctat
cagaagtgccttgtcatgggtatgaagagggaagctgtgcaagaggagagacagagaagc
cgcgagagggctgagaatgaagtggagtccaccagcagtggccatgaagacatgccggtg
gagaggatcctcgaagcggaacttgctgttgaaccaaagactgaatcctatggagacaca
aacatggagaactcgacaaatgatcccgtcaccaacatatgccatgctgctgataagcag
ctctttactcttgttgaatgggccaaacgcatcccccacttctctgacctcaccttggaa
gaccaagttattcttcttcgggcaggctggaacgaattgctgattgcctccttctcccat
cgctcggtgtctgtacaggatggaatcctccttgccactggtttgcacgtccaccgaagc
agtgctcacagcgctggggttgggtccatctttgacagagttctcactgagctggtttct
aaaatgaaagacatgcagatggataaatccgagttaggctgcctgcgggccattgtcctg
tttaacccagatgctaagggcttgtccaatccctctgaagtggaggctctccgagagaaa
gtttatgctacccttgaagcatataccaagcagaaataccctgatcagcctggcaggttt
gccaagctcctgcttcgactcccagccctccggtccattggcttgaaatgtcttgagcac
ctcttcttctttaagctcattggagacacacccattgatacttttctcatggagatgctg
gaaaccccactccagattacctga

DBGET integrated database retrieval system