KEGG   Phascolarctos cinereus (koala): 110199423
Entry
110199423         CDS       T05867                                 

Gene name
ATF6B
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04022  cGMP-PKG signaling pathway
pcw04141  Protein processing in endoplasmic reticulum
pcw04151  PI3K-Akt signaling pathway
pcw04211  Longevity regulating pathway
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04668  TNF signaling pathway
pcw04728  Dopaminergic synapse
pcw04911  Insulin secretion
pcw04915  Estrogen signaling pathway
pcw04918  Thyroid hormone synthesis
pcw04925  Aldosterone synthesis and secretion
pcw04926  Relaxin signaling pathway
pcw04927  Cortisol synthesis and secretion
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04934  Cushing syndrome
pcw04935  Growth hormone synthesis, secretion and action
pcw05020  Prion disease
pcw05030  Cocaine addiction
pcw05031  Amphetamine addiction
pcw05034  Alcoholism
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110199423 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110199423 (ATF6B)
   04022 cGMP-PKG signaling pathway
    110199423 (ATF6B)
   04151 PI3K-Akt signaling pathway
    110199423 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110199423 (ATF6B)
   04915 Estrogen signaling pathway
    110199423 (ATF6B)
   04926 Relaxin signaling pathway
    110199423 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    110199423 (ATF6B)
   04918 Thyroid hormone synthesis
    110199423 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    110199423 (ATF6B)
   04925 Aldosterone synthesis and secretion
    110199423 (ATF6B)
   04927 Cortisol synthesis and secretion
    110199423 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110199423 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    110199423 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    110199423 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110199423 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    110199423 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    110199423 (ATF6B)
   05031 Amphetamine addiction
    110199423 (ATF6B)
   05034 Alcoholism
    110199423 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110199423 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110199423 (ATF6B)
   05161 Hepatitis B
    110199423 (ATF6B)
   05163 Human cytomegalovirus infection
    110199423 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110199423 (ATF6B)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110199423 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 YabA ZapB DUF3275
Other DBs
NCBI-GeneID: 110199423
NCBI-ProteinID: XP_020829936
LinkDB
Position
Unknown
AA seq 708 aa
MAAELLLLSEIADPARFFADNLLSAEDWDRTLYNCLDEVTEEQAQLFRCLEQDVPFDSGS
LDMGMDITSPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSLLSTEPLGQASVGEEVL
GVKIESPSPPHCLLGNVLKPSFGAIQISVGLTPDDPSDTQTKTEPISPSSPLSSEASLLS
TESPSKPLVEEEVLGVKTESPAPQLCLLGDVLTSPFGSVQINVGPAPDACSGKAPPHRKP
PLQPKPVMVTNVPLPPRNSPPSTTVLLQPLGQPPPVPSGPSVVLFQGPVQVQPPVGEGPA
PPTPRLERKSIVPAPMPGTLCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEAR
LQVVLADNQQLRRENAALRRRLEGLLAENSELKFGSGNRKVVCVMVFLLFIAFNFGPVSI
NESPPAPASPPMGKEESWPQRHLLEFSEQGVIPGEDTQGTPLGHKESQPRPPGQSHFKNL
TTFPKGAKELLLRDLDQFFLSSDCRHFNRTESLRLADELSGWVQRHQSGRKKSPQPRKVR
EKQKSHQWKKPPSAWSVPPRPSGPLERDSVSQLQLYHHPRRPQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGNTGDYEVMMQIECEVMDTRVI
HIKSSTVPPSLRKQPPPSPGNASGNPLPPPAPSSSRQAPHQPFYLDHP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggcggcggaactgctactgctcagcgaaatcgccgatccggctcgtttctttgcagac
aacctgctcagcgctgaggactgggaccgcaccctctataattgccttgatgaagtgact
gaggagcaagctcagctcttcagatgtctggaacaagatgtcccgtttgatagcggctcc
ctggacatgggcatggacatcacctcccctgagcccccatgggacccactgcccatcttc
ccagacttacaggtgaagtcagaaccttcttccccttgctcctcctcttctctcagctcc
gagtcatcacttctctccacggagccccttggccaggcctctgtgggagaagaggtactt
ggtgtgaagatagaatctcctagccctccacactgcctcttggggaatgttctgaaacct
tcatttggagctatccagattagtgtgggcctcaccccagatgacccctcagatacacag
accaagacagaacccatttcaccttcttcccctcttagctcagaggcctcattgctctcc
acagaatcccccagtaagcctcttgtagaagaggaggtgttaggagtaaagacagaatca
ccagcccctcaactctgccttctaggggatgtcctgacttccccatttggatcagtccaa
attaatgtgggtccagcccctgatgcttgctcaggaaaggccccaccccatcggaagcca
ccactgcaaccgaagcctgttatggtgacaaatgtcccactgcctccccgaaattcacct
cctagcaccacagtcttgttgcagcccctaggccagcctccaccagtcccatctgggcct
tccgtagtccttttccagggccctgttcaagtacagccacctgtgggggaggggccagct
ccccccaccccccgattggagaggaagagcattgtgccagctcccatgcctgggactcta
tgtcctccagaggtggatgcaaagctgctgaagcgtcagcagcggatgatcaagaaccgt
gagtcagcctgccagtcccggaggaagaagaaggaatatctgcaagggctggaggctcgg
ctccaagtggtccttgcagacaaccagcagctccgccgtgagaatgcagctctccgaaga
cggctggaggggctgctggcagagaacagtgaactaaagtttgggtctgggaataggaag
gtcgtctgtgtcatggtcttcctcctcttcatcgccttcaactttgggcctgtgagcatc
aatgaatcacctccagctccagcctcacctccgatgggcaaggaagagtcttggccccag
aggcacctcctagagttctcagagcaaggggtaattcctggggaggacacccagggaaca
ccgctgggccacaaggaatcacagcctaggccccctggccagtcacatttcaagaaccta
acaacctttcccaagggagccaaggaactgttgctgagagacttagaccagtttttcctc
tcctctgactgtcgtcacttcaaccggactgagtctctccggcttgcagatgaacttagt
ggctgggtccagcgacaccagagtggaagaaagaagagtcctcagccccggaaggtcagg
gaaaaacagaagtctcaccagtggaagaaaccaccttcagcctggtcagtccctcctcgg
ccctctggcccccttgaaagggactctgtgagccagctgcagctgtatcaccaccccaga
cgtccacagccagagttcctagatgccattgaccgtcgggaagacacattctacgtcgtc
tccttccgaagggatcacctgttgctcccagcaatcagccacaacaagacttctcgccca
aagatgtctttggtgatgccagccatggcccccaatgagaccctgtcgggccggggcaat
acaggggactatgaggtgatgatgcagatcgaatgtgaggtcatggacaccagggtcatc
cacatcaagagctccacagtgcccccctcccttcgaaagcagcctcccccctcccctggc
aatgcttcaggcaaccccttgcctcctccagcacccagctcttctaggcaagctcctcac
cagcccttctacctcgatcacccctaa

DBGET integrated database retrieval system