KEGG   Phascolarctos cinereus (koala): 110199476
Entry
110199476         CDS       T05867                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00562  Inositol phosphate metabolism
pcw01100  Metabolic pathways
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04070  Phosphatidylinositol signaling system
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04213  Longevity regulating pathway - multiple species
pcw04218  Cellular senescence
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04611  Platelet activation
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04668  TNF signaling pathway
pcw04670  Leukocyte transendothelial migration
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04923  Regulation of lipolysis in adipocytes
pcw04926  Relaxin signaling pathway
pcw04929  GnRH secretion
pcw04930  Type II diabetes mellitus
pcw04931  Insulin resistance
pcw04932  Non-alcoholic fatty liver disease
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw04960  Aldosterone-regulated sodium reabsorption
pcw04973  Carbohydrate digestion and absorption
pcw05010  Alzheimer disease
pcw05017  Spinocerebellar ataxia
pcw05020  Prion disease
pcw05100  Bacterial invasion of epithelial cells
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05142  Chagas disease
pcw05146  Amoebiasis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110199476 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110199476 (PIK3CD)
   04014 Ras signaling pathway
    110199476 (PIK3CD)
   04015 Rap1 signaling pathway
    110199476 (PIK3CD)
   04370 VEGF signaling pathway
    110199476 (PIK3CD)
   04630 JAK-STAT signaling pathway
    110199476 (PIK3CD)
   04668 TNF signaling pathway
    110199476 (PIK3CD)
   04066 HIF-1 signaling pathway
    110199476 (PIK3CD)
   04068 FoxO signaling pathway
    110199476 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    110199476 (PIK3CD)
   04072 Phospholipase D signaling pathway
    110199476 (PIK3CD)
   04071 Sphingolipid signaling pathway
    110199476 (PIK3CD)
   04024 cAMP signaling pathway
    110199476 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    110199476 (PIK3CD)
   04152 AMPK signaling pathway
    110199476 (PIK3CD)
   04150 mTOR signaling pathway
    110199476 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110199476 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    110199476 (PIK3CD)
   04218 Cellular senescence
    110199476 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110199476 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    110199476 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110199476 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110199476 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    110199476 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    110199476 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    110199476 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    110199476 (PIK3CD)
   04660 T cell receptor signaling pathway
    110199476 (PIK3CD)
   04662 B cell receptor signaling pathway
    110199476 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    110199476 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    110199476 (PIK3CD)
   04670 Leukocyte transendothelial migration
    110199476 (PIK3CD)
   04062 Chemokine signaling pathway
    110199476 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110199476 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    110199476 (PIK3CD)
   04929 GnRH secretion
    110199476 (PIK3CD)
   04915 Estrogen signaling pathway
    110199476 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    110199476 (PIK3CD)
   04917 Prolactin signaling pathway
    110199476 (PIK3CD)
   04926 Relaxin signaling pathway
    110199476 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    110199476 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    110199476 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110199476 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110199476 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    110199476 (PIK3CD)
   04722 Neurotrophin signaling pathway
    110199476 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110199476 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    110199476 (PIK3CD)
   04380 Osteoclast differentiation
    110199476 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    110199476 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    110199476 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110199476 (PIK3CD)
   05206 MicroRNAs in cancer
    110199476 (PIK3CD)
   05205 Proteoglycans in cancer
    110199476 (PIK3CD)
   05203 Viral carcinogenesis
    110199476 (PIK3CD)
   05230 Central carbon metabolism in cancer
    110199476 (PIK3CD)
   05231 Choline metabolism in cancer
    110199476 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110199476 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110199476 (PIK3CD)
   05212 Pancreatic cancer
    110199476 (PIK3CD)
   05225 Hepatocellular carcinoma
    110199476 (PIK3CD)
   05226 Gastric cancer
    110199476 (PIK3CD)
   05214 Glioma
    110199476 (PIK3CD)
   05221 Acute myeloid leukemia
    110199476 (PIK3CD)
   05220 Chronic myeloid leukemia
    110199476 (PIK3CD)
   05218 Melanoma
    110199476 (PIK3CD)
   05211 Renal cell carcinoma
    110199476 (PIK3CD)
   05215 Prostate cancer
    110199476 (PIK3CD)
   05213 Endometrial cancer
    110199476 (PIK3CD)
   05224 Breast cancer
    110199476 (PIK3CD)
   05222 Small cell lung cancer
    110199476 (PIK3CD)
   05223 Non-small cell lung cancer
    110199476 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110199476 (PIK3CD)
   05017 Spinocerebellar ataxia
    110199476 (PIK3CD)
   05020 Prion disease
    110199476 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110199476 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110199476 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    110199476 (PIK3CD)
   04931 Insulin resistance
    110199476 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110199476 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110199476 (PIK3CD)
   05135 Yersinia infection
    110199476 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    110199476 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110199476 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    110199476 (PIK3CD)
   05161 Hepatitis B
    110199476 (PIK3CD)
   05160 Hepatitis C
    110199476 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    110199476 (PIK3CD)
   05164 Influenza A
    110199476 (PIK3CD)
   05162 Measles
    110199476 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    110199476 (PIK3CD)
   05163 Human cytomegalovirus infection
    110199476 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110199476 (PIK3CD)
   05169 Epstein-Barr virus infection
    110199476 (PIK3CD)
   05165 Human papillomavirus infection
    110199476 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110199476 (PIK3CD)
   05142 Chagas disease
    110199476 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110199476 (PIK3CD)
   01524 Platinum drug resistance
    110199476 (PIK3CD)
   01522 Endocrine resistance
    110199476 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110199476 (PIK3CD)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110199476 (PIK3CD)
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110199476 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 110199476
NCBI-ProteinID: XP_020830013
UniProt: A0A6P5J7B6
LinkDB
Position
Unknown
AA seq 1046 aa
MPPGVDCPMEFWSKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHHAQYEPLFH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVARQGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWEAWMHYNFPLQLEPCARGLGT
GTLRVPNRTLLVNVKFEGNEESFTFQVSPNDFPLALMACALKKRATVFRQSAMERPEDYT
LKVNGKFEYLYGGYPLHQFQYICNCLHKGLTPHLTMVHSSSILAMRDEQSNPTAQAPKLR
TKPPPIPVKKPSSVSLWSLEQPFCIELVQGSKVNADERMKLVVLAGLFHGNEMLCKTVSS
SEVTVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWSSVPDEKGELLNPMGTVRSNPNTESAAALVICIPEVAP
HPVYYPTMEKILELGKNGEHGRFTEDELQQLREILERKVAAELYEHEKDLVWKMRHEIQE
QFPEALARLLLVTKWNKHEDVAQMLFLLGSWPELPVLSALELLDFSFPDRHVGSFAIQSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSNHHMKALMKQGEALNKMKALNDFVKVSSQKTTKPQTKELMHVCMR
QETYLEALSNVQSPLNPSTLLSEVCVEQCTFMDSKMKPLWIVYSNEEAGGGGDSHVGIIF
KNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVSHSDTIANIQ
LNKSNMAATAAFNKDALLNWLKSKNPGEALERAIEEFTLSCAGYCVATYVLGIGDRHSDN
IMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRS
YCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRVK
FNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgcccccgggagtcgactgtcctatggaattctggtccaaggaagaaaaccagagcgtg
gtggtagatttcttgttgcctacaggggtctacctgaacttccccgtctctcgaaatgcc
aacctcagcaccatcaaacaggtcctctggcaccatgcccagtatgagcccctgttccac
atgctcagtgaccccgaagcctacgtcttcacctgcatcaaccagacggccgagcagcag
gagctggaggacgagcagcggcgcctctgtgacatccagcccttcctgcctgtgctgcgg
ctcgtggcccgccagggggaccgcgtgaagaagcttatcaattctcagatcagcctcctc
atcgggaagggtctgcacgagtttgactctctgcgggacccagaagtcaatgacttccgc
accaagatgcgccagttctgtgaagaggcggcagcccaccggcagcagctgggctgggag
gcctggatgcattacaacttcccgttacagctggagccctgtgcccggggcttggggacc
gggacactgcgcgtccccaacaggaccctccttgtcaatgtcaagtttgagggcaatgag
gaaagcttcaccttccaggtgtctcccaatgactttcccttggccctcatggcctgtgcc
ctcaagaagagggccaccgtgtttcggcagtcagccatggagcggccagaggactacacc
ctgaaggtgaacgggaagttcgagtacctgtatggcggctaccccctccaccagttccag
tatatctgcaattgcctccacaaggggctgaccccccatctcaccatggtgcactcctcc
tccatcctggctatgcgagatgagcagagcaaccccactgcgcaggccccaaagctccgc
accaagccgcccccgatccctgtgaagaagccgtcctccgtgtccctctggtccctggag
cagcccttctgcatcgagctggttcagggcagcaaggtgaatgcggacgagaggatgaag
ctcgtggtcctggccggtctcttccacgggaatgagatgctgtgtaagacggtgtccagc
tctgaggtgaccgtgtgctcggagcccgtgtggaaacagcgccttgagtttgacatcaat
atctgtgacctgccccgcatggcccggctctgctttgccctctacgctgtcatcgagaag
gccaagaaggctcgttccaccaaaaaaaagtccaagaaggcggactgtcctattgcttgg
gccaacctcatgctgtttgactacaaggaccagctgaagactggcgagtgctgcctgtac
atgtggtcctccgtcccagatgagaaaggggagctgctgaaccccatgggcactgtgcgg
agtaaccccaacactgagagtgccgctgccctggttatctgcatcccggaagtcgctcca
caccctgtgtactaccccaccatggagaagatcttggagctggggaaaaacggggagcac
ggacgcttcactgaggatgagctgcagcagctgcgggagatcctggagcgcaaggtggcc
gcagagctgtatgagcacgagaaggacctggtgtggaagatgcgccatgagatccaggag
cagttccctgaggccctggccaggctcctgctggtcactaagtggaacaagcacgaggat
gtggcccagatgctcttcctgctgggctcctggcccgagctcccggtgttgagcgccctg
gagctgctggacttcagcttccccgaccgccacgtgggctccttcgccatccagtccttg
aggaaactgacggatgacgagctctttcaatacctgctgcagctggtacaggtactcaag
tacgaatcctacctagactgtgagttgaccaagttcctgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctgcgctcagagatgcacgtcccctctgtg
gctctgcgctttggcctgatcatggaggcctattgccggggcagcaaccaccacatgaag
gcactgatgaagcagggggaggcactgaataaaatgaaggcactgaatgactttgtcaaa
gtgagctcccagaagaccaccaagccacagaccaaggaattgatgcatgtgtgtatgagg
caggagacctacttagaggccctctcgaacgtgcaatctcccctgaaccccagtacctta
ctgtctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcctttgtgg
attgtgtacagcaatgaggaggccggaggaggtggggacagccacgttggcatcatcttt
aagaacggtgatgatctccgccaggacatgctgactcttcagatgatccagctgatggac
gtcctgtggaagcaggaggggctggacctgaggatgactccctacggctgcctctccacg
ggggaccggacggggctcatcgaggtggtgtcacactcggacaccatcgccaacatccag
ctcaacaaaagcaacatggccgccacagcagccttcaataaagacgccctgctgaactgg
ctgaagtccaagaaccctggggaggccttggagcgagccatcgaggagttcacgctctct
tgtgcgggctactgtgtggcgacctacgtgttgggcatcggagatcggcacagcgacaac
atcatgatccgagagagcgggcagctcttccatatcgattttggccatttcttgggcaat
ttcaagaccaaatttggaatcaaccgtgaacgagtcccattcatcctcacctatgatttt
gtccacgtgatccaacagggaaaaaccaacaacaatgagaagtttgagaggttccgcagt
tactgtgaaagggcgtacaccatcctgcgtcgccacggcctccttttccttcacctcttt
gctctgatgcgggcagcgggactgcctgaactcagctgctccaaagacatccagtatctc
aaggactcactggccttggggaaaacagatgaagaggccctgaagcacttccgagtgaag
tttaatgaagcccttcgagaaagctggaaaaccaaagtgaactggctggcccacaacgtg
tccaaagacaaccggcagtag

KEGG   Phascolarctos cinereus (koala): 110204454
Entry
110204454         CDS       T05867                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00562  Inositol phosphate metabolism
pcw01100  Metabolic pathways
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04070  Phosphatidylinositol signaling system
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04213  Longevity regulating pathway - multiple species
pcw04218  Cellular senescence
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04611  Platelet activation
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04668  TNF signaling pathway
pcw04670  Leukocyte transendothelial migration
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04923  Regulation of lipolysis in adipocytes
pcw04926  Relaxin signaling pathway
pcw04929  GnRH secretion
pcw04930  Type II diabetes mellitus
pcw04931  Insulin resistance
pcw04932  Non-alcoholic fatty liver disease
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw04960  Aldosterone-regulated sodium reabsorption
pcw04973  Carbohydrate digestion and absorption
pcw05010  Alzheimer disease
pcw05017  Spinocerebellar ataxia
pcw05020  Prion disease
pcw05100  Bacterial invasion of epithelial cells
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05142  Chagas disease
pcw05146  Amoebiasis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110204454 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110204454 (PIK3CA)
   04014 Ras signaling pathway
    110204454 (PIK3CA)
   04015 Rap1 signaling pathway
    110204454 (PIK3CA)
   04370 VEGF signaling pathway
    110204454 (PIK3CA)
   04630 JAK-STAT signaling pathway
    110204454 (PIK3CA)
   04668 TNF signaling pathway
    110204454 (PIK3CA)
   04066 HIF-1 signaling pathway
    110204454 (PIK3CA)
   04068 FoxO signaling pathway
    110204454 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    110204454 (PIK3CA)
   04072 Phospholipase D signaling pathway
    110204454 (PIK3CA)
   04071 Sphingolipid signaling pathway
    110204454 (PIK3CA)
   04024 cAMP signaling pathway
    110204454 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    110204454 (PIK3CA)
   04152 AMPK signaling pathway
    110204454 (PIK3CA)
   04150 mTOR signaling pathway
    110204454 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110204454 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    110204454 (PIK3CA)
   04218 Cellular senescence
    110204454 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110204454 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    110204454 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110204454 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110204454 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    110204454 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    110204454 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    110204454 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    110204454 (PIK3CA)
   04660 T cell receptor signaling pathway
    110204454 (PIK3CA)
   04662 B cell receptor signaling pathway
    110204454 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    110204454 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    110204454 (PIK3CA)
   04670 Leukocyte transendothelial migration
    110204454 (PIK3CA)
   04062 Chemokine signaling pathway
    110204454 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110204454 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    110204454 (PIK3CA)
   04929 GnRH secretion
    110204454 (PIK3CA)
   04915 Estrogen signaling pathway
    110204454 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    110204454 (PIK3CA)
   04917 Prolactin signaling pathway
    110204454 (PIK3CA)
   04926 Relaxin signaling pathway
    110204454 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    110204454 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    110204454 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110204454 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110204454 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    110204454 (PIK3CA)
   04722 Neurotrophin signaling pathway
    110204454 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110204454 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    110204454 (PIK3CA)
   04380 Osteoclast differentiation
    110204454 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    110204454 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    110204454 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110204454 (PIK3CA)
   05206 MicroRNAs in cancer
    110204454 (PIK3CA)
   05205 Proteoglycans in cancer
    110204454 (PIK3CA)
   05203 Viral carcinogenesis
    110204454 (PIK3CA)
   05230 Central carbon metabolism in cancer
    110204454 (PIK3CA)
   05231 Choline metabolism in cancer
    110204454 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110204454 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110204454 (PIK3CA)
   05212 Pancreatic cancer
    110204454 (PIK3CA)
   05225 Hepatocellular carcinoma
    110204454 (PIK3CA)
   05226 Gastric cancer
    110204454 (PIK3CA)
   05214 Glioma
    110204454 (PIK3CA)
   05221 Acute myeloid leukemia
    110204454 (PIK3CA)
   05220 Chronic myeloid leukemia
    110204454 (PIK3CA)
   05218 Melanoma
    110204454 (PIK3CA)
   05211 Renal cell carcinoma
    110204454 (PIK3CA)
   05215 Prostate cancer
    110204454 (PIK3CA)
   05213 Endometrial cancer
    110204454 (PIK3CA)
   05224 Breast cancer
    110204454 (PIK3CA)
   05222 Small cell lung cancer
    110204454 (PIK3CA)
   05223 Non-small cell lung cancer
    110204454 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110204454 (PIK3CA)
   05017 Spinocerebellar ataxia
    110204454 (PIK3CA)
   05020 Prion disease
    110204454 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110204454 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110204454 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    110204454 (PIK3CA)
   04931 Insulin resistance
    110204454 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110204454 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110204454 (PIK3CA)
   05135 Yersinia infection
    110204454 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    110204454 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110204454 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    110204454 (PIK3CA)
   05161 Hepatitis B
    110204454 (PIK3CA)
   05160 Hepatitis C
    110204454 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    110204454 (PIK3CA)
   05164 Influenza A
    110204454 (PIK3CA)
   05162 Measles
    110204454 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    110204454 (PIK3CA)
   05163 Human cytomegalovirus infection
    110204454 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110204454 (PIK3CA)
   05169 Epstein-Barr virus infection
    110204454 (PIK3CA)
   05165 Human papillomavirus infection
    110204454 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110204454 (PIK3CA)
   05142 Chagas disease
    110204454 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110204454 (PIK3CA)
   01524 Platinum drug resistance
    110204454 (PIK3CA)
   01522 Endocrine resistance
    110204454 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110204454 (PIK3CA)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110204454 (PIK3CA)
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110204454 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 Ribosomal_S15
Other DBs
NCBI-GeneID: 110204454
NCBI-ProteinID: XP_020836340
UniProt: A0A6P5JXC9
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDVHAPHSRALYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEHVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGEASTKSLWGINSALRIRILCATYVNVNIRDIDKIYVRTGI
CHGGEPLCDNVNTQRVPCSNPRWNEWLMYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SNPVKFPDMSVIEEHANWTVSRELGFNYSHAGLSNRIARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVNIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatccggtgaattgtggggcatccatttgatgcccccaagaatc
ttagtagaatgtcttctacctaatggaatgatagtgactttagaatgcctccgtgaggct
acattagtaactattaaacatgagctatttaaagaagcaaggaaataccctcttcaccag
ctccttcaggatgaaacttcttacattttcgtaagtgttactcaagaagcagaaagagaa
gaattttttgatgaaacacggcgactttgtgacctacggctttttcagccttttctaaaa
gtcatcgaacctgtaggcaaccgagaagaaaaaattctcaatcgagaaattggttttgct
attggtatgcctgtttgtgaatttgatatggttaaagatccagaagtacaagacttccga
agaaatattcttaatgtttgtaaagaagctgtggacctgagggatgtccatgcaccccat
agtagagcattatatgtctatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatacaataaattagataaagggcaaataatagtggtgatttgggtgatagtttcccca
aacaatgacaagcagaagtacactttaaaaatcaatcatgactgtgtaccagaacatgtg
atcgctgaagcaatccggaaaaaaacacggagtatgttgctgtcgtctgagcagctgaag
ctctgtgttttagagtatcagggcaaatacattttaaaagtgtgtggatgtgatgagtat
ttgctagaaaaatatcctcttagccaatataagtacataagaagctgtataatgcttggt
cggatgcccaatctgatgctgatggctaaagaaagtctttacacccagctaccactggat
acttttacaatgccatcttattccaggcgaatctccacagccaccccatacatgaatgga
gaagcttcaaccaaatccctttggggcataaatagtgcactccgcataagaattctttgt
gcaacttatgtaaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
tgccatgggggagagccattatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccagatggaatgaatggctaatgtatgatatatacattcctgatcttccacgtgctgct
cgactttgcctttccatttgttctgttaaaggcaggaaaggggcaaaagaggaacattgc
ccgttggcttggggaaatatcaacctctttgattatacagacactttggtatcaggaaaa
atggctttgaatctgtggccagtacctcatggattagaagatttgctgaatcccattgga
gttactgggtcaaatcccaataaggaaactccatgtttagagctggaatttgactggttt
agcaatcctgtaaagttcccagacatgtcagtgattgaagaacatgctaattggactgta
tctcgagaactaggatttaactattcccatgctgggctgagtaataggatagctcgagat
aatgaattaagagaaaatgataaagaacagctccgggcaatttgtacaagagaccctctg
tctgagatcactgagcaagaaaaggactttctgtggagtcacaggcattattgtgtcaat
ataccagaaattctacctaaacttcttctgtctgttaagtggaattctagagatgaagta
gcccagatgtattgcttggtaaaagactggcccccaatcaaaccagaacaggccatggaa
cttttggactgtaactatccagaccctatggttcgagcttttgctgttcgatgcttggag
aaatatttaactgatgacaaactttctcagtacttaattcaactagttcaggttctgaag
tatgaacaatatttggataaccttcttgtgagatttttactcaagaaagcactaacaaat
caaaggataggacactttttcttttggcatttaaagtctgaaatgcataataaaactgtc
agccaaagatttggcttgcttttggagtcgtactgccgagcatgtgggatgtatctaaaa
catttgaaccggcaggtagaggccatggagaaactgattaacctcaccgacattctcaaa
caggaaaagaaggatgagacacaaaaggtacagatgaagttcttggttgagcaaatgaga
cggcctgattacatggatgctttacaaggctttatctctccccttaaccctgctcatcaa
ctaggaaatctcaggctcgaagagtgtcggattatgtcctctgccaaaagaccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactatttcagaacaatgagatcatc
tttaaaaatggggatgacttacgacaggatatgctaacccttcagatcattcgaattatg
gaaaatatctggcaaaatcaaggtcttgatcttcggatgctaccttatggttgtctatca
attggggactgtgttggcctcattgaggtggtcagaagttctcacactatcatgcagatt
caatgtaaaggtggcctgaaaggggccttgcagttcaacagccatacgttacatcagtgg
ctcaaagacaagaataaaggagaaatatatgatgcagccattgatttgtttacacgttca
tgtgctggatactgcgtggcgaccttcattttgggaattggcgatcgccacaatagcaat
atcatggtgaaagatgatggacaactatttcacatagactttggacactttttggatcac
aagaaaaagaaatttggctataaacgagagcgtgtacccttcgtcttgacgcaagatttc
ttaattgtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagagattt
caagaaatgtgctataaggcttacttagctattcggcaacacgccaatctcttcatcaat
cttttctctatgatgcttggttctggaatgcctgaactacagtcttttgatgatatcgca
tatattcgaaagaccctggccttggataagactgagcaggaggctttggagtatttcatg
aagcaaatgaatgatgctcaccatgggggctggacaaccaaaatggattggattttccat
acaatcaagcagcatgctttgaactga

KEGG   Phascolarctos cinereus (koala): 110208219
Entry
110208219         CDS       T05867                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00562  Inositol phosphate metabolism
pcw01100  Metabolic pathways
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04070  Phosphatidylinositol signaling system
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04213  Longevity regulating pathway - multiple species
pcw04218  Cellular senescence
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04611  Platelet activation
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04668  TNF signaling pathway
pcw04670  Leukocyte transendothelial migration
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04923  Regulation of lipolysis in adipocytes
pcw04926  Relaxin signaling pathway
pcw04929  GnRH secretion
pcw04930  Type II diabetes mellitus
pcw04931  Insulin resistance
pcw04932  Non-alcoholic fatty liver disease
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw04960  Aldosterone-regulated sodium reabsorption
pcw04973  Carbohydrate digestion and absorption
pcw05010  Alzheimer disease
pcw05017  Spinocerebellar ataxia
pcw05020  Prion disease
pcw05100  Bacterial invasion of epithelial cells
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05142  Chagas disease
pcw05146  Amoebiasis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110208219 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110208219 (PIK3CB)
   04014 Ras signaling pathway
    110208219 (PIK3CB)
   04015 Rap1 signaling pathway
    110208219 (PIK3CB)
   04370 VEGF signaling pathway
    110208219 (PIK3CB)
   04630 JAK-STAT signaling pathway
    110208219 (PIK3CB)
   04668 TNF signaling pathway
    110208219 (PIK3CB)
   04066 HIF-1 signaling pathway
    110208219 (PIK3CB)
   04068 FoxO signaling pathway
    110208219 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    110208219 (PIK3CB)
   04072 Phospholipase D signaling pathway
    110208219 (PIK3CB)
   04071 Sphingolipid signaling pathway
    110208219 (PIK3CB)
   04024 cAMP signaling pathway
    110208219 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    110208219 (PIK3CB)
   04152 AMPK signaling pathway
    110208219 (PIK3CB)
   04150 mTOR signaling pathway
    110208219 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110208219 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    110208219 (PIK3CB)
   04218 Cellular senescence
    110208219 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110208219 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    110208219 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110208219 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110208219 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    110208219 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    110208219 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    110208219 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    110208219 (PIK3CB)
   04660 T cell receptor signaling pathway
    110208219 (PIK3CB)
   04662 B cell receptor signaling pathway
    110208219 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    110208219 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    110208219 (PIK3CB)
   04670 Leukocyte transendothelial migration
    110208219 (PIK3CB)
   04062 Chemokine signaling pathway
    110208219 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110208219 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    110208219 (PIK3CB)
   04929 GnRH secretion
    110208219 (PIK3CB)
   04915 Estrogen signaling pathway
    110208219 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    110208219 (PIK3CB)
   04917 Prolactin signaling pathway
    110208219 (PIK3CB)
   04926 Relaxin signaling pathway
    110208219 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    110208219 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    110208219 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110208219 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110208219 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    110208219 (PIK3CB)
   04722 Neurotrophin signaling pathway
    110208219 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110208219 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    110208219 (PIK3CB)
   04380 Osteoclast differentiation
    110208219 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    110208219 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    110208219 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110208219 (PIK3CB)
   05206 MicroRNAs in cancer
    110208219 (PIK3CB)
   05205 Proteoglycans in cancer
    110208219 (PIK3CB)
   05203 Viral carcinogenesis
    110208219 (PIK3CB)
   05230 Central carbon metabolism in cancer
    110208219 (PIK3CB)
   05231 Choline metabolism in cancer
    110208219 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110208219 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110208219 (PIK3CB)
   05212 Pancreatic cancer
    110208219 (PIK3CB)
   05225 Hepatocellular carcinoma
    110208219 (PIK3CB)
   05226 Gastric cancer
    110208219 (PIK3CB)
   05214 Glioma
    110208219 (PIK3CB)
   05221 Acute myeloid leukemia
    110208219 (PIK3CB)
   05220 Chronic myeloid leukemia
    110208219 (PIK3CB)
   05218 Melanoma
    110208219 (PIK3CB)
   05211 Renal cell carcinoma
    110208219 (PIK3CB)
   05215 Prostate cancer
    110208219 (PIK3CB)
   05213 Endometrial cancer
    110208219 (PIK3CB)
   05224 Breast cancer
    110208219 (PIK3CB)
   05222 Small cell lung cancer
    110208219 (PIK3CB)
   05223 Non-small cell lung cancer
    110208219 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110208219 (PIK3CB)
   05017 Spinocerebellar ataxia
    110208219 (PIK3CB)
   05020 Prion disease
    110208219 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110208219 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110208219 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    110208219 (PIK3CB)
   04931 Insulin resistance
    110208219 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110208219 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110208219 (PIK3CB)
   05135 Yersinia infection
    110208219 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    110208219 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110208219 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    110208219 (PIK3CB)
   05161 Hepatitis B
    110208219 (PIK3CB)
   05160 Hepatitis C
    110208219 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    110208219 (PIK3CB)
   05164 Influenza A
    110208219 (PIK3CB)
   05162 Measles
    110208219 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    110208219 (PIK3CB)
   05163 Human cytomegalovirus infection
    110208219 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110208219 (PIK3CB)
   05169 Epstein-Barr virus infection
    110208219 (PIK3CB)
   05165 Human papillomavirus infection
    110208219 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110208219 (PIK3CB)
   05142 Chagas disease
    110208219 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110208219 (PIK3CB)
   01524 Platinum drug resistance
    110208219 (PIK3CB)
   01522 Endocrine resistance
    110208219 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110208219 (PIK3CB)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110208219 (PIK3CB)
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110208219 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 110208219
NCBI-ProteinID: XP_020841785
UniProt: A0A6P5KAG0
LinkDB
Position
Unknown
AA seq 1069 aa
MCFSFIMPPAMADILDFWGVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISNIKQMLW
KQAHNYPMFNLLMEIEAYMFACVNQTAVYEELEDETRRLCDIRPFLSVLKVVTRNCDPGE
KLDSKIGVLIGKGLHEFDALEDPEVNEFRSKMRQFSEEKIQSLVGLSWMDWLKHTYPPEQ
EPSIPENLEDKLYGGNLVVAVHFENCQDVFSFQVSPNMNPIKLNELAIRKRLTIRGKEDE
VDPYDYVLQVSGRLEYVFGDHPLIQFQYIRNCVMNRTLPKLTLVECCNIKKMCEQEMIAI
EAAINRNSSNLPLPLPPKKTRLISNVWENTQPFQIILVKGTKLNTEETVKVHVRAGLFHG
TELLCKPVVSSEISGRNDRVWSEPLEFDINICDLPRMARLCFAVYAVDKVKTKKSTKTIN
PSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLKAGDIILHSWSSFPDELEEMLNPMGTVQT
NPYIENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSGNVSSRGGKKFHAVLKEI
MERDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSVKWNKLEDVAQLQALLQIWPKL
PPREALELLDFNYPDQYVREYAVSCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSRFML
DRALANRRIGQFLFWHLRSEVHIPAFSVQFGVILEAYCRGSVGYMKVLSKQVEALNKLKT
LNSLIKLNAVKLNKAKGREAMHTCLKQNAYREALSDLPSPLNPCVILSELYVEKCKYMDS
KMKPLRIVYNNKVFGGDPVGIIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGC
LATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDQAIEEF
TLSCAGYCVASYVLGIGDRHSDNIMVRKTGQLFHIDFGHILGNFKSKFGIKRERVPFILT
YDFIHVIQQGKTGNTEKFNRFRKCCEEAYLILRRHGNLFITLFALMLTAGLPELTSVKDI
QYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTMRKDYRS
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgtgcttcagttttataatgcctcctgctatggcagacatccttgacttttggggcgtg
gattctcagatagcatcagatggctccattcctgtggattttttattgcccactgggatc
tatatccaattggaagtacctcgggaggccactatttctaatattaaacagatgctatgg
aagcaagctcacaactatcctatgtttaaccttcttatggaaattgaagcttatatgttt
gcatgtgtgaaccagactgctgtttatgaggagcttgaagatgaaacaagaagactttgt
gatatcagaccttttctttcagttctcaaagtggtgacaagaaattgtgacccaggggaa
aaattagattccaaaattggagttcttataggaaaaggtcttcatgagtttgatgcccta
gaagatcccgaagtgaatgagttccgaagtaaaatgcgccagttcagtgaagaaaagatc
cagtcccttgtggggttgtcttggatggattggttaaagcatacttacccaccagaacaa
gaaccttctattcctgaaaacttggaagataaactttatggtggaaatcttgtggtagct
gtccattttgaaaattgtcaggatgtatttagtttccaagtatctcctaatatgaatccc
atcaagctaaatgagttagcaatccgaaaacggttgactatccgtggaaaggaagatgaa
gttgatccttatgactatgtgctacaagtcagtgggagactagaatatgtgtttggtgat
cacccattaattcagttccagtatatacggaactgtgtcatgaatagaactcttcccaaa
ctcactcttgttgaatgttgcaatatcaagaagatgtgtgaacaggaaatgattgccata
gaagctgccataaatcgaaattcatccaaccttcctcttccactgccaccaaaaaaaaca
cgattaatttctaatgtttgggagaatacccagcctttccaaattatattggttaagggg
actaaactgaacacagaagaaactgtcaaagttcatgtcagggctggactttttcatgga
actgaacttctttgcaaaccggttgtaagctcagagatatctgggagaaatgaccgtgtt
tggagtgaaccactggaatttgatattaacatctgtgatttaccaagaatggctcggtta
tgctttgcagtttatgctgtagataaagtgaaaacaaaaaagtcgaccaagacaattaat
ccctccaaatatcagactatcaggaaagctggaaaagtgcactatcctgtagcatgggta
aataccatggtgtttgactttaaaggacagctgaaagctggagatatcatattgcacagc
tggtcatcatttcctgatgagcttgaagaaatgttgaatccaatgggaactgttcaaaca
aatccatatattgaaaatgcaacagctttacatgttaaattccctgagaataaaaagcag
ccttattattaccctccctttgataagattattgagaaggcagctgagattgcaagtagt
gacagtggtaacgtatcaagtcgaggtggaaaaaaatttcatgctgtgctcaaagaaatc
atggagagggatcccttatcccaactgtgtgaaaatgaaatggatcttatttggactttg
agacaagactgtagagaaaattttccacagtcattgccaaaattgctgctgtctgtcaaa
tggaataaacttgaagatgttgctcagctacaggctcttcttcagatatggcctaaactg
cctcctagagaagcattggaattattagactttaattatccagaccagtatgtaagagag
tatgcagtgagctgcttgaaacaaatgagtgacgaagaactatctcagtacctcctacaa
cttgtacaagttttgaaatacgaaccttttcttgattgtgccctatctagattcatgtta
gacagagcacttgctaataggaggatagggcagtttctattttggcatcttaggtcagaa
gtacacattcctgccttttcagtacaatttggtgtaatacttgaagcttactgtcgagga
agtgtgggctatatgaaagtgctttctaaacaggttgaagctctaaataagctgaagacc
ttaaatagtttaataaaattgaacgcagtaaaattaaacaaagcaaaaggaagagaggca
atgcacacatgcttaaaacaaaatgcttaccgagaagccctttctgatcttccgtcacct
ttgaatccttgtgtcatactctcagaactttatgttgagaagtgcaagtacatggattct
aaaatgaagcctctgagaatagtatacaacaacaaagtatttggaggagatccagtgggt
atcattttcaaaaatggggatgatctacggcaagatatgttgactctccaaatgttgcgg
ttgatggatttactttggaaagaggctggattggatctccgaatgctgccgtatggttgt
ttagcaacaggagaccgctctggccttatagaagttgttagtacatctgaaacaattgcc
gatatccagctaaatagtagtaatgttgctgctacagctgccttcaataaagatgctctt
ctaaattggcttaaagaatacaattctggggatgacttagatcaagccattgaagagttc
acactctcctgtgctggctactgtgtagcttcttatgtcctggggatcggtgatagacac
agtgacaacatcatggtcaggaaaactggacagctcttccacatcgattttggacatatt
cttggaaacttcaagtctaaatttggcattaaacgggaacgagtgcctttcattcttacc
tatgatttcattcatgtcattcagcaaggaaaaacaggaaacacagaaaagtttaaccgg
ttccgtaagtgttgtgaagaggcttacctgattttacgaaggcatgggaatctctttatc
actctgtttgccctgatgttgactgcagggcttcctgagctcacctcagttaaggatata
cagtatcttaaggactctttggccttggggaagagtgaggaagaagcactaaagcagttt
aagcagaaatttgatgaggcgctcagggagagttggactactaaagtaaactggatggcg
cacaccatgaggaaagattaccggtcttaa

DBGET integrated database retrieval system