KEGG   Phascolarctos cinereus (koala): 110200158
Entry
110200158         CDS       T05867                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04010  MAPK signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04144  Endocytosis
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04540  Gap junction
pcw04630  JAK-STAT signaling pathway
pcw04810  Regulation of actin cytoskeleton
pcw05163  Human cytomegalovirus infection
pcw05200  Pathways in cancer
pcw05206  MicroRNAs in cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110200158 (PDGFRA)
   04014 Ras signaling pathway
    110200158 (PDGFRA)
   04015 Rap1 signaling pathway
    110200158 (PDGFRA)
   04630 JAK-STAT signaling pathway
    110200158 (PDGFRA)
   04020 Calcium signaling pathway
    110200158 (PDGFRA)
   04072 Phospholipase D signaling pathway
    110200158 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    110200158 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110200158 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110200158 (PDGFRA)
   04540 Gap junction
    110200158 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110200158 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110200158 (PDGFRA)
   05206 MicroRNAs in cancer
    110200158 (PDGFRA)
   05230 Central carbon metabolism in cancer
    110200158 (PDGFRA)
   05231 Choline metabolism in cancer
    110200158 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    110200158 (PDGFRA)
   05218 Melanoma
    110200158 (PDGFRA)
   05215 Prostate cancer
    110200158 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110200158 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110200158 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110200158 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pcw04090]
    110200158 (PDGFRA)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110200158 (PDGFRA)
Protein kinases [BR:pcw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110200158 (PDGFRA)
CD molecules [BR:pcw04090]
 Proteins
  110200158 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Adeno_E3_CR1
Other DBs
NCBI-GeneID: 110200158
NCBI-ProteinID: XP_020830991
LinkDB
Position
Unknown
AA seq 1086 aa
MGASPWAFLVLGCLFTGPWLTFCQLPLPTVFPNEDEKVVQLHSSFTLRCSGDSEVSWQYP
MQDEEDQKIEVRNEENNSGLFVTVLEVVNASAVHTGLYTCYYNHTQTEETEVEGKDIYIY
VPDPDVAFVPSAMVDHLIFAEEHDSVTIPCRTTDPQAQVILLNSDDKVVHAFYDSRQGFV
GNFAMGQFKCETVIKGKKFQTVPFNIYTITATPELEVEIEAVKTVYKTGETLVVTCAVLH
NEVVDLQWNYPGKVKNKGILKVDEIKVPSLKLVYTLTVPKVTVKDSGDYECAARHATKET
KEIKKVTISVHEKGFIELKPNFSQMETINLHEVRHFVVDVQAYPPPKISWLKDNMTVIEN
LTEIITGLDKIQEIRYQSKLKLIRAKEEDSGYYTIMAQNEDDTKNYTFELTIQVPASILD
LEDDNHGSAGGQTVRCVAEGTPLPVVEWMICKDITKCSNETSWTLLASNMSDITTQKQDG
SMVKSQVTFNKIEDTMAVRCLAKNSLGAVNRELKLVAPAMRSELTVAASVLVLLVIVIFS
LIILIVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGS
GAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLL
GACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSHHPEKTKKELDIFGMNSADESTRSYV
ILSFENNGDYMDMKQADTTQYVPMLERKQGSKYSDIQRSMYDRPASYKKKSVSDPEVKNL
LSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVECDNAYIGVTYKNEDKLKDWEGTYDEQRLSADSGYIIPL
PDIDPIPEDDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDL
VEDSFL
NT seq 3261 nt   +upstreamnt  +downstreamnt
atgggtgcctccccatgggcgttcctggtcttgggatgtctcttcacagggccgtggctc
acattttgccagcttccattacccactgtctttccgaatgaggatgaaaaggttgtgcag
ctgcattcatcttttaccctaagatgctctggggacagtgaagtgagctggcagtacccc
atgcaggatgaagaggaccaaaaaatagaagtcagaaatgaggagaacaacagtggcctt
tttgtgacagtcctggaagtggtcaatgcctcagctgtacacacagggctgtacacttgt
tactataaccatactcagacagaggagactgaggttgaaggcaaagacatctacatctat
gtgccagatccagatgtagcctttgtaccttcagccatggttgatcatttaatttttgcg
gaggaacatgattctgtcactattccatgtcgcacaactgatcctcaggcccaagtgatc
ctactcaacagtgatgacaaagtggtccatgcattctatgatagcagacagggctttgtt
ggaaactttgctatgggacaattcaagtgtgagacagtcatcaaagggaagaagttccag
acagttccattcaacatttatacaataacagctactccagagcttgaagttgagatagag
gcagtgaaaactgtttataaaacaggagaaactcttgttgtaacttgtgctgtcttgcac
aatgaggtggttgaccttcagtggaattaccctggaaaagtgaaaaacaaaggcattttg
aaagttgatgaaatcaaagttccatctctcaagttggtgtatacactgactgtcccaaag
gtgacagtgaaagacagtggagactatgaatgtgctgcccgtcatgctaccaaggaaact
aaagaaatcaagaaagttaccatctctgttcatgagaagggatttattgagctcaaaccc
aacttcagccagatggaaaccattaacttgcatgaagtccgccattttgtagtggatgtg
caagcgtatccacccccaaagatatcctggcttaaggataatatgactgtgattgagaat
ctgactgaaatcatcactggcttagataagatccaggaaataagatatcaaagcaagtta
aaactgattcgtgctaaggaagaagacagtggatattatactattatggctcaaaatgag
gatgatactaagaattatacttttgaacttacaattcaagttccagcttctattctggac
ctggaggatgataaccatggctctgcaggtgggcagacggtcagatgtgtagcagaaggg
acaccacttccagttgtggaatggatgatttgcaaggatattacaaagtgtagtaatgaa
acttcatggacacttttggccagcaacatgtccgacataactacacagaaacaggatggt
agtatggtgaagagccaagtgaccttcaacaaaattgaagatactatggctgtgcgatgc
ctagcaaagaactcacttggagcagtgaaccgggaactgaaacttgtggctcctgctatg
cgttcagaattgacagtggctgcttcagtccttgtgttgctagtgattgtcattttttcc
ctcattatcctaattgtcatatggaaacagaaacccaggtatgaaattcggtggagagtt
atcgaatctatcagccctgatggccatgagtacatttatgtggatccgatgcagctgcct
tatgactcaagatgggagtttcctagagatgggttagtccttggtcgaatcctgggctca
ggtgcatttggaaaagtggttgaagggactgcatatggattaagccgttcccagcctgtg
atgaaggtggcagtgaaaatgctaaaacccacagctagatccagtgaaaaacaggccctc
atgtcggaactgaagataatgactcatctgggaccccacttaaatattgtaaatcttcta
ggagcgtgtaccaagtcagggcccatttatatcatcactgaatactgcttctatggggac
ttggtcaactacctgcataagaacagagataacttcctgagccaccatccagagaagaca
aagaaggaactagacatctttgggatgaactcagccgatgaaagcacaaggagctatgtc
attttatcctttgaaaacaatggggattatatggacatgaagcaagctgataccacacag
tatgtccctatgctggaaagaaaacagggctcgaaatattcagatattcaaagatcgatg
tatgaccgacctgcatcgtacaagaagaaatctgtatcagatccagaagtgaaaaacctc
ctttcagatgacagctctgaaggtctcagtctcttggatctgttgagcttcacctatcaa
gttgcccgaggaatggaatttttggcttcaaaaaattgtgttcatcgtgacctggctgct
cgcaatgtgcttctggctcaagggaaaattgtgaagatctgtgactttggcctggccaga
gacatcatgcatgattccaactatgtgtccaagggcagtacttttctcccagtgaagtgg
atggctcctgaaagtatctttgacaatctgtataccacgctgagcgacgtctggtcttat
ggcatcctgctgtgggagattttctcccttggaggcacaccctaccctggaatgatggtg
gattctactttctataataaaatcaaaagtggataccggatggccaaacccgaccatgcc
accagtgaagtatatgagatcatggtgaagtgctggaacagcgagccagagaagagacca
tccttttaccacctgagtgagattgtggaaaatctgctgcctgggcagtataagaagagt
tatgagaaaatccacttggactttttgaagagtgaccatcctgctgttgctcgcatgaga
gtcgagtgtgataacgcttacattggtgtcacctacaaaaatgaagacaagttaaaggac
tgggaaggcacctatgacgaacagaggttgagtgctgacagtggctatatcatccctctg
cctgacattgaccctatccctgaagatgacctaggcaagagaaacagacacagttcccag
acatctgaggaaagtgccattgagacaggttccagcagctccaccttcatcaagagagag
gatgaaaccattgaggacatcgacatgatggatgacattgggatagactcctcagacctg
gttgaagacagcttcctgtaa

DBGET integrated database retrieval system