KEGG   Phascolarctos cinereus (koala): 110200196Help
Entry
110200196         CDS       T05867                                 

Gene name
ELOVL1
Definition
(RefSeq) elongation of very long chain fatty acids protein 1
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00062  Fatty acid elongation
pcw01040  Biosynthesis of unsaturated fatty acids
pcw01100  Metabolic pathways
pcw01212  Fatty acid metabolism
Module
pcw_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    110200196 (ELOVL1)
   01040 Biosynthesis of unsaturated fatty acids
    110200196 (ELOVL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pcw01004]
    110200196 (ELOVL1)
Enzymes [BR:pcw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     110200196 (ELOVL1)
Lipid biosynthesis proteins [BR:pcw01004]
 Elongase
  PUFA
   110200196 (ELOVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 110200196
NCBI-ProteinID: XP_020831068
LinkDB All DBs
Position
Unknown
AA seq 276 aa AA seqDB search
MESLINLYHEVMKKADPRLQGYPLMDTPLLMTSILVAYVYFVLSLGPRLMANRKPLQLRG
FMVTYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDFSQNPEALRMVRVAWLFLFSKFI
ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVRVAPGGMGSFHAMVNSSVHVVMYL
YYGLSALGPAAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFLPSCDYQYPVIIHLIWIYG
TVFFVLFSNFWYQSYTKGKRLPRAVQQNGVPKVKAN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggagtccttaatcaacttgtaccatgaagtgatgaagaaagcagatccccggctccag
ggctaccccttgatggacaccccgctgctcatgacctccatccttgtggcctatgtctac
tttgtgctgtccttggggccccggctgatggccaatcggaaaccactccagcttcgaggc
ttcatggtcacatacaacttctccctggtggctttgtccctctacatagtctatgagttc
ctgatgtctggctggctgagcacctacacatggcgttgcgaccctgtggacttttcccag
aaccctgaggcccttcggatggttcgtgtggcttggctctttctgttctcaaagttcatc
gaactgatggatacggtaatctttattcttcgaaagaaggatggtcaggtgactttcttg
catgtcttccatcactctgtgctgccctggagctggtggtggggcgttagggtggcccca
ggaggaatgggttccttccatgccatggtgaactcctctgtccatgtggtcatgtacctt
tattatgggctgtctgctttgggcccagcagcccagccctatctgtggtggaagaagcac
atgacagctatccagctgatccagtttgtgctggtctcattgcacatctctcagtattat
ttcctgcccagctgtgactaccagtaccctgtgatcatccacctcatctggatatatggc
accgtcttctttgtgctcttctccaacttctggtatcaatcctatacaaagggcaaacgg
ctgcccagggctgtccagcagaatggagtgcccaaagtcaaggcgaactga

DBGET integrated database retrieval system