KEGG   Phascolarctos cinereus (koala): 110200334
Entry
110200334         CDS       T05867                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01523  Antifolate resistance
pcw04010  MAPK signaling pathway
pcw04014  Ras signaling pathway
pcw04062  Chemokine signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04380  Osteoclast differentiation
pcw04620  Toll-like receptor signaling pathway
pcw04621  NOD-like receptor signaling pathway
pcw04622  RIG-I-like receptor signaling pathway
pcw04623  Cytosolic DNA-sensing pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04657  IL-17 signaling pathway
pcw04658  Th1 and Th2 cell differentiation
pcw04659  Th17 cell differentiation
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04668  TNF signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05212  Pancreatic cancer
pcw05215  Prostate cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05340  Primary immunodeficiency
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110200334 (IKBKG)
   04014 Ras signaling pathway
    110200334 (IKBKG)
   04064 NF-kappa B signaling pathway
    110200334 (IKBKG)
   04668 TNF signaling pathway
    110200334 (IKBKG)
   04151 PI3K-Akt signaling pathway
    110200334 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110200334 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110200334 (IKBKG)
   04621 NOD-like receptor signaling pathway
    110200334 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    110200334 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    110200334 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    110200334 (IKBKG)
   04660 T cell receptor signaling pathway
    110200334 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    110200334 (IKBKG)
   04659 Th17 cell differentiation
    110200334 (IKBKG)
   04657 IL-17 signaling pathway
    110200334 (IKBKG)
   04662 B cell receptor signaling pathway
    110200334 (IKBKG)
   04062 Chemokine signaling pathway
    110200334 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110200334 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110200334 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110200334 (IKBKG)
   05203 Viral carcinogenesis
    110200334 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110200334 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110200334 (IKBKG)
   05221 Acute myeloid leukemia
    110200334 (IKBKG)
   05220 Chronic myeloid leukemia
    110200334 (IKBKG)
   05215 Prostate cancer
    110200334 (IKBKG)
   05222 Small cell lung cancer
    110200334 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    110200334 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110200334 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110200334 (IKBKG)
   05135 Yersinia infection
    110200334 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110200334 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    110200334 (IKBKG)
   05162 Measles
    110200334 (IKBKG)
   05164 Influenza A
    110200334 (IKBKG)
   05161 Hepatitis B
    110200334 (IKBKG)
   05160 Hepatitis C
    110200334 (IKBKG)
   05168 Herpes simplex virus 1 infection
    110200334 (IKBKG)
   05163 Human cytomegalovirus infection
    110200334 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110200334 (IKBKG)
   05169 Epstein-Barr virus infection
    110200334 (IKBKG)
   05165 Human papillomavirus infection
    110200334 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110200334 (IKBKG)
   05142 Chagas disease
    110200334 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110200334 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110200334 (IKBKG)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110200334 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 110200334
NCBI-ProteinID: XP_020831260
LinkDB
Position
Unknown
AA seq 575 aa
MNEHHCKSQPSEMVQPNGGPSGDYETLGEGSSLGKSAMLHLPSNQVSPEALQRFLEENQE
LRDALRQSNHMLRQRYQEFLNFQANQKEEKEFLMRKFQEARKLVEKLNMEKLELKRQKEK
ALQESEQGQIPGEMEREALRTLKEQLEERLRHFQEASESLQKEKQVLLLENQELRKKAAQ
GQAGETQLKMKDCGIQPQRLLETESLQGASGSGRSEDSNNLLKKKMQDVENENTVLKQEL
ASLQGKVAQLAVREKDVERRAEQQLQALKRQLEQLTEDKGSVKAQVTSLLGELQESQSRL
EVSNKDKQVLEDRARAATEKVKQLESENEQLHKQHSVQVDQLRMQTQNVEAALRMERQAA
SEEKRKLAQLQVAYHQLFQEYDNHIKNSQASSERSRGMDLQLEDLNQQLQQAEEALVAKQ
ELIDKLKEEAEQHKTVMETIPVLKAQADIYKADFQAERQAREKLAERKELLQDQLEQLQR
EYNKLRVDSKETTRAMNTTFCFQSIEDMRKRHVENPQPALPQPVHLVNHHLSFHPILPGQ
RRSLPDEQPDFCCPKCQYQAPDIDTLQIHVMECIE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgaacgaacatcattgcaagagtcagcctagtgagatggtacaacccaacgggggtcca
tcaggagattacgagacccttggtgaagggtcttccctggggaaatcagccatgctgcat
ctcccttccaaccaagtctctccggaggccctccagcgcttcttggaggagaaccaagag
ctcagagatgccttacgacagagcaaccacatgctccggcagcgttatcaagagttcctg
aacttccaagccaaccagaaggaggagaaggagtttctcatgagaaaatttcaggaggct
aggaaactggtggagaagctaaacatggagaagctggagctgaagagacagaaggagaag
gcgctgcaggaaagcgagcagggtcagatcccaggtgagatggaaagagaggctttgagg
accctgaaggagcagctagaagagcgtttgcgacactttcaagaggccagtgaaagcctc
cagaaggagaaacaagtccttcttctggagaaccaggagctgaggaagaaagcagctcaa
ggccaagctggggagacccagctgaagatgaaggactgtgggatccaaccacaaagactg
ctggagacagaatctctgcaaggggcaagtggcagtggtaggagtgaggattcaaacaac
ttgctgaagaagaagatgcaggatgttgagaatgagaacacggtgctgaagcaggagctg
gcgtccctgcagggcaaggtggcccagttggcagtgagggaaaaagatgtggagaggagg
gccgagcagcagttacaggccctgaagaggcagttggagcaactgacggaagacaaagga
tctgtgaaagcccaggtgacctcactgctcggggagctgcaggagagccagagccgcctg
gaggtttcaaacaaggacaaacaagtcctagaggaccgagcccgggcagccactgagaag
gtcaagcagctggagagcgagaatgagcagctgcacaaacaacacagtgtgcaggtggac
cagctgcgcatgcagacccagaatgtggaggctgccttacggatggagcggcaggctgca
tctgaggagaagcggaagctggctcaattacaagtggcctaccaccagctctttcaggaa
tatgacaaccatatcaagaatagccaagcgagcagtgagcgcagtaggggaatggatctt
cagttggaagacctcaatcagcagttgcaacaggcagaagaggccctggtagccaaacag
gaattgattgacaaactcaaggaggaggctgaacaacacaagacagtgatggagacgatc
ccggtcctgaaggcacaggctgatatctacaaggctgacttccaggcagagcggcaagcc
cgggagaaactggcagagcggaaggagcttctgcaagatcagctggagcagctccagagg
gagtataacaaactgagagttgactcgaaagaaaccacccgggctatgaacacaactttc
tgctttcaaagtattgaagatatgagaaaacggcatgtagagaaccctcagccagctttg
ccccagccagttcatcttgtcaatcatcacctctcctttcatcccatactacctggccag
aggagaagtcttccggatgaacagccagatttttgttgtccgaaatgtcagtatcaggcc
ccagatattgacactctgcagatacatgtcatggaatgtattgagtga

DBGET integrated database retrieval system