KEGG   Phascolarctos cinereus (koala): 110201000Help
Entry
110201000         CDS       T05867                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw05034  Alcoholism
pcw05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110201000 (HDAC6)
  09165 Substance dependence
   05034 Alcoholism
    110201000 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110201000 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcw03019]
    110201000 (HDAC6)
   04131 Membrane trafficking [BR:pcw04131]
    110201000 (HDAC6)
   03036 Chromosome and associated proteins [BR:pcw03036]
    110201000 (HDAC6)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110201000 (HDAC6)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110201000 (HDAC6)
Messenger RNA biogenesis [BR:pcw03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110201000 (HDAC6)
Membrane trafficking [BR:pcw04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    110201000 (HDAC6)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110201000 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110201000
NCBI-ProteinID: XP_020832073
LinkDB All DBs
Position
Unknown
AA seq 875 aa AA seqDB search
MASQQEKPGPSHRGGSPSRSPSAGTRMMGQKRGGRKGSPVPRASPSLAEARRRGRAKKLS
QVSEQDLVTNLQDLDLEAESAVPSGTGLVLDERMGGFHCSWDESFPERPERLQAVQEQLA
RDGLLERCVHIEARPATPQELQLVHSQEYIELMASTPQMTESELRTLSDTYDSVYLHPNS
FPCALLATGALLRLVDALMVGEIRNGLALVRPPGHHAQRENMNGYCMFNNVAIAARYAQE
KHHVSRILIVDWDVHHGQGIQFIFEQDPSVLYFSVHRYEQGRFWPHLKASDWRATGSGKG
QGYTVNVPWNQVGMRDGDYISSFLHVLLPIALEFQPQMVLVAAGFDAMLGDPKGEMAATP
GGFAHLTHLLMSLARGKLILCLEGGYNLCSLALGVSATLQTLLGDPCPMLATPCVPCPSA
LASLSCTLAAHRPFWKVIQRFQSAPEDKEKDHREVSLGPPPNLEALGKPLEQALPLPLNR
TGLVYDERMMEHFNMWDSHHPERPERIAQIAQHHTELGLSPRCLPLPARSATDDELLSCH
SEEYIDRVRATSGLKPRDLHREGESYNSIYISPHSFSCARLAAGAACSLVEAILAREVQN
GLAIVRPPGHHAERDAACGFCFFNSVAVAARHAQEVAGRALRILIVDWDIHHGNGTQHIF
EEDPSVLYVSLHRYDHGAFFPVAEDGASSCVGQGQGEGFNVNVAWNGPRIGDPDYLTAMH
HIVMPIAYEFNPELVLVSAGFDAARGDPLGGCLVSPEGYAHMTHLLMGLAGGHIALVLEG
GYNLTSISESMAACTRTLLGDPPPSLPWLRPPLPGAFLSLAEVAQTHRKYWQSLRLTAVK
TRRKQRRPHWSWLRWRAPWGTSFLKRALQRHWPQD
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccagcaggagaagccaggcccgagtcatcgaggagggagccccagcagatct
ccctcggccggaacccggatgatggggcaaaagcgaggaggccggaagggatcaccagtc
ccgagagccagcccaagtttagctgaggcccgtcgcagagggcgagcaaagaaattgagt
caagtgtctgagcaagacctggtgaccaacctgcaagacctggaccttgaggcagagtca
gcagtaccctcagggactggcctggtgctggatgagagaatgggtggattccactgctcc
tgggatgaaagtttccctgaaagaccggaacgccttcaggctgtgcaggaacaactggcc
agggacggtctgcttgagcggtgtgtccacattgaggcccgtccagctactccccaggag
ctgcagcttgtccatagccaagaatacatagagctgatggcatccacaccacagatgact
gaatcggagcttcggaccctctcagacacctacgattctgtctacctgcacccgaactca
tttccttgtgccctcttggctactggggcgctgcttcggctggtggatgccttgatggta
ggcgagatccggaacggactagctcttgtcaggccccctggccatcatgcccagcgtgag
aacatgaatggctactgtatgttcaacaatgttgccattgctgcccgctatgcccaggaa
aagcaccatgtgtcacggatactcattgtggattgggatgtccaccatggtcaaggcata
cagttcatcttcgagcaggacccaagcgtcctctacttctccgttcaccgctatgagcag
ggtcgattctggccccacctaaaagcttctgactggcgggcaacagggagtggcaagggt
cagggatacactgtcaatgtgccttggaaccaggtggggatgagggatggggattacatc
agctccttcttacatgtgctgctgcccatcgctctggagtttcagcctcagatggttctg
gtggccgctggctttgatgccatgctgggggaccccaagggagaaatggcggccactccg
gggggttttgcccacctcactcacttgctcatgagtctggctagggggaagctgattctg
tgtctggagggcggctacaatttgtgttctcttgctttgggggtcagtgccactcttcag
accctcctgggagacccatgtcccatgttggccacaccttgtgtcccctgccccagtgct
ctggcttccttgtcctgtaccctggctgctcacagacctttctggaaggttatacagagg
tttcagtctgcccctgaggacaaggagaaagatcacagggaggtgagcctaggccccccg
cccaatcttgaggccctggggaaacccttggaacaggccctgcccctgcctctgaaccga
acaggcttggtatatgatgagaggatgatggagcatttcaatatgtgggacagccaccac
ccagagcggccagaacgcatcgcccagatcgcacagcaccacacggagcttgggctgagc
cctcgatgcctccctttgcctgcccgttccgctacggatgatgagctgttgagctgccac
agcgaggagtatattgaccgtgttcgggccacaagtgggctgaagcctcgggacctgcac
agggagggtgaaagttataactccatctacatctccccccattccttcagctgtgcccgg
cttgctgccggagctgcttgcagtttggtggaggccatcttggccagggaggtgcagaat
gggcttgccattgtccgcccaccaggccaccacgctgaaagagatgctgcctgtggtttc
tgcttcttcaattctgtggccgtggctgctcgccatgctcaggaggtggcaggccgggcc
ctccgaatcctgattgtggattgggacattcatcatggcaatggaacacagcacatattt
gaggaagacccaagtgtgctgtacgtatccttgcaccgctatgatcacggcgccttcttc
cccgtggctgaggatggtgctagcagctgtgtgggccagggccagggagagggtttcaac
gtcaatgtggcatggaacgggccccgcattggcgatcctgactacctcaccgccatgcac
catattgtgatgcccattgcctacgagttcaaccctgagttggtgctggtgtctgctggc
tttgatgctgctcggggggacccactaggaggttgcctagtctccccagagggctacgca
cacatgactcatctgctgatggggttggctggtggccacattgccctggtcctcgagggt
ggctacaacctaacatccatctcagaatctatggctgcttgtacccggacccttctaggt
gacccacccccatcgctcccctggcttcggcctccgctgcctggggccttcctctccctg
gctgaggttgcccagacccaccggaagtactggcagagccttcggcttactgcagtaaag
accaggaggaaacaaaggagacctcactggagctggttgagatggagagcaccctggggc
acgagcttcctgaagagagccctgcagaggcactggccacaggactaa

DBGET integrated database retrieval system