KEGG   Phascolarctos cinereus (koala): 110201017
Entry
110201017         CDS       T05867                                 

Gene name
ARAF
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04068  FoxO signaling pathway
pcw04270  Vascular smooth muscle contraction
pcw04650  Natural killer cell mediated cytotoxicity
pcw04720  Long-term potentiation
pcw04726  Serotonergic synapse
pcw04730  Long-term depression
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw05010  Alzheimer disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05034  Alcoholism
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110201017 (ARAF)
   04012 ErbB signaling pathway
    110201017 (ARAF)
   04068 FoxO signaling pathway
    110201017 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110201017 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110201017 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110201017 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    110201017 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    110201017 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110201017 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    110201017 (ARAF)
   04720 Long-term potentiation
    110201017 (ARAF)
   04730 Long-term depression
    110201017 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110201017 (ARAF)
   05205 Proteoglycans in cancer
    110201017 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110201017 (ARAF)
   05212 Pancreatic cancer
    110201017 (ARAF)
   05225 Hepatocellular carcinoma
    110201017 (ARAF)
   05226 Gastric cancer
    110201017 (ARAF)
   05214 Glioma
    110201017 (ARAF)
   05221 Acute myeloid leukemia
    110201017 (ARAF)
   05220 Chronic myeloid leukemia
    110201017 (ARAF)
   05218 Melanoma
    110201017 (ARAF)
   05211 Renal cell carcinoma
    110201017 (ARAF)
   05219 Bladder cancer
    110201017 (ARAF)
   05215 Prostate cancer
    110201017 (ARAF)
   05213 Endometrial cancer
    110201017 (ARAF)
   05224 Breast cancer
    110201017 (ARAF)
   05223 Non-small cell lung cancer
    110201017 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110201017 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    110201017 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    110201017 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110201017 (ARAF)
   05160 Hepatitis C
    110201017 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110201017 (ARAF)
   01522 Endocrine resistance
    110201017 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110201017 (ARAF)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110201017 (ARAF)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110201017 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like Pkinase_fungal zf-RING-like APH C1_2 Kdo TUG-UBL1
Other DBs
NCBI-GeneID: 110201017
NCBI-ProteinID: XP_020832123
UniProt: A0A6P5JFE7
LinkDB
Position
Unknown
AA seq 623 aa
MRRGPTATPVEPSRGLTPPEDSDAIPPTSSRVGGTVKVYLPNQQRTVVTARDGMTVSDSL
DKALKVRGLNQDCCAVYRLVQGRKTATAWDAAIAPLHGEELTVEVRADVPLAAAHNFARK
TFLALTFCDFCRRFLFHGFRCQTCGYKFHQHCSARVPTVCVDMATARQPFYRSVQDLTGG
PGAHEPQPGRQTLCEPLAPKSPRTQTQASHGETFAFPGPGGPPLQRIRSTSTPNVHMIST
TLPVDSRLIQQAAQAVAAEGTVGEKTPQGSPGPSLVSSPGRKSPHPKFSSEPPERKPLSF
ADDKKKVKSLGYRDSGYYWEVAPGEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPT
AEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPAFAIITQWCEGSSLYHHLHVAETHFDMV
QLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQQVE
QPTGSVLWMASEVIRMQDKNPYSFQSDVYAYGVVLYELMSGSLPYSHINNRDQIIFMVGR
GYLSPDLTKVSNNCPKAMKRLLADCLRFQREERPLFPEILVTIELLQRVLPKIERSASEP
SLHRAQTEELPSSLLGALRLFGP
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgagacgaggcccgactgccaccccagtggaaccctccaggggcctaaccccgcctgag
gattctgatgccatccctcccaccagcagtcgggttgggggcactgtgaaggtctatctg
cccaaccagcagcgcacagtggtaactgcgcgggatggcatgaccgtctccgactcgttg
gacaaggcactgaaggtgcggggactgaaccaagactgctgcgctgtctaccgcctcgtg
cagggacggaagaccgcaacagcctgggacgcagccattgctcccttgcacggggaagaa
ctgacggtcgaggtccgggctgatgttccgctcgcggctgcccataactttgcccggaag
acattcctggctctcaccttctgtgacttctgccgccgcttcctcttccatggtttccgt
tgccagacatgtggttacaagttccaccaacactgcagtgcccgcgtccccactgtctgc
gttgacatggccaccgcccgccaacctttctaccgcagtgtccaggacttgactggaggc
cctggtgctcatgagccccagcctggcaggcagaccctatgtgagcccctcgccccaaag
agccccaggacacaaacacaggcctcccatggggagacttttgctttccctgggcctgga
ggcccaccccttcagaggatccgctctacatccacacccaatgtgcacatgatcagcacg
acattgcctgtggacagcaggctcatacagcaggcagcccaggccgttgctgctgaagga
acagtgggggagaagaccccccaaggcagtcctggccccagcctcgtgtcctcccctgga
aggaaatccccacaccccaagttctcatcagagccccctgagcgcaagccccttagcttc
gctgatgataagaagaaagtgaagtctctgggctaccgagactcaggctactattgggag
gtagccccaggggaggtgcaactgctgaagaggatcgggacaggctcatttgggactgtg
ttccgtgggcgatggcatggggatgtggctgtgaaggtgttaaaggtggcgcagcccaca
gctgagcaggcccaggccttcaagaatgagatgcaggtcctcaggaagactcgccatgtg
aatatcctcttgttcatgggattcatgacaaggcccgcctttgccatcatcacccagtgg
tgtgagggttccagcctctaccaccacttgcacgtggctgagactcactttgatatggta
caactcatcgatgtggcccggcagacagctcagggcatggattatctccatgccaagaac
atcattcaccgagatctcaaatccaacaatatctttctgcacgaggggctgacagtgaag
attggagactttgggctggccacagtgaagacccgatggagcggtgcccagcaagtagag
cagcccactggctctgtgctctggatggcctcagaggtgatccgaatgcaggacaagaat
ccctacagcttccagtcggatgtctatgcctacggggtggtcttgtatgagctcatgagt
ggcagtcttccctatagccacatcaacaacagagatcagatcatcttcatggtaggacga
ggttatctgtcgccagacctcaccaaggtctccaacaactgtcctaaagccatgaagaga
ctgctggcagactgtctccgtttccagcgggaggaacggcccttgttccccgagatcctg
gtcaccattgagctgctgcagcgagtgctgcctaagattgagcgcagcgcgtcagagccc
tcgctgcaccgggcccagaccgaggaactgccttcctccttgctgggagccctgcgcctc
ttcgggccctag

KEGG   Phascolarctos cinereus (koala): 110204892
Entry
110204892         CDS       T05867                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04218  Cellular senescence
pcw04270  Vascular smooth muscle contraction
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04371  Apelin signaling pathway
pcw04510  Focal adhesion
pcw04540  Gap junction
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04613  Neutrophil extracellular trap formation
pcw04625  C-type lectin receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04720  Long-term potentiation
pcw04722  Neurotrophin signaling pathway
pcw04726  Serotonergic synapse
pcw04730  Long-term depression
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04912  GnRH signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04916  Melanogenesis
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04926  Relaxin signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04929  GnRH secretion
pcw04935  Growth hormone synthesis, secretion and action
pcw05010  Alzheimer disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05034  Alcoholism
pcw05132  Salmonella infection
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110204892 (RAF1)
   04012 ErbB signaling pathway
    110204892 (RAF1)
   04014 Ras signaling pathway
    110204892 (RAF1)
   04015 Rap1 signaling pathway
    110204892 (RAF1)
   04370 VEGF signaling pathway
    110204892 (RAF1)
   04371 Apelin signaling pathway
    110204892 (RAF1)
   04630 JAK-STAT signaling pathway
    110204892 (RAF1)
   04068 FoxO signaling pathway
    110204892 (RAF1)
   04072 Phospholipase D signaling pathway
    110204892 (RAF1)
   04071 Sphingolipid signaling pathway
    110204892 (RAF1)
   04024 cAMP signaling pathway
    110204892 (RAF1)
   04022 cGMP-PKG signaling pathway
    110204892 (RAF1)
   04151 PI3K-Akt signaling pathway
    110204892 (RAF1)
   04150 mTOR signaling pathway
    110204892 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110204892 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    110204892 (RAF1)
   04218 Cellular senescence
    110204892 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110204892 (RAF1)
   04540 Gap junction
    110204892 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110204892 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110204892 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110204892 (RAF1)
   04625 C-type lectin receptor signaling pathway
    110204892 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    110204892 (RAF1)
   04660 T cell receptor signaling pathway
    110204892 (RAF1)
   04662 B cell receptor signaling pathway
    110204892 (RAF1)
   04664 Fc epsilon RI signaling pathway
    110204892 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    110204892 (RAF1)
   04062 Chemokine signaling pathway
    110204892 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110204892 (RAF1)
   04929 GnRH secretion
    110204892 (RAF1)
   04912 GnRH signaling pathway
    110204892 (RAF1)
   04915 Estrogen signaling pathway
    110204892 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    110204892 (RAF1)
   04917 Prolactin signaling pathway
    110204892 (RAF1)
   04921 Oxytocin signaling pathway
    110204892 (RAF1)
   04926 Relaxin signaling pathway
    110204892 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    110204892 (RAF1)
   04919 Thyroid hormone signaling pathway
    110204892 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    110204892 (RAF1)
   04916 Melanogenesis
    110204892 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110204892 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    110204892 (RAF1)
   04720 Long-term potentiation
    110204892 (RAF1)
   04730 Long-term depression
    110204892 (RAF1)
   04722 Neurotrophin signaling pathway
    110204892 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    110204892 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110204892 (RAF1)
   05206 MicroRNAs in cancer
    110204892 (RAF1)
   05205 Proteoglycans in cancer
    110204892 (RAF1)
   05230 Central carbon metabolism in cancer
    110204892 (RAF1)
   05231 Choline metabolism in cancer
    110204892 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110204892 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110204892 (RAF1)
   05212 Pancreatic cancer
    110204892 (RAF1)
   05225 Hepatocellular carcinoma
    110204892 (RAF1)
   05226 Gastric cancer
    110204892 (RAF1)
   05214 Glioma
    110204892 (RAF1)
   05221 Acute myeloid leukemia
    110204892 (RAF1)
   05220 Chronic myeloid leukemia
    110204892 (RAF1)
   05218 Melanoma
    110204892 (RAF1)
   05211 Renal cell carcinoma
    110204892 (RAF1)
   05219 Bladder cancer
    110204892 (RAF1)
   05215 Prostate cancer
    110204892 (RAF1)
   05213 Endometrial cancer
    110204892 (RAF1)
   05224 Breast cancer
    110204892 (RAF1)
   05223 Non-small cell lung cancer
    110204892 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110204892 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    110204892 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    110204892 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110204892 (RAF1)
   05152 Tuberculosis
    110204892 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110204892 (RAF1)
   05161 Hepatitis B
    110204892 (RAF1)
   05160 Hepatitis C
    110204892 (RAF1)
   05164 Influenza A
    110204892 (RAF1)
   05163 Human cytomegalovirus infection
    110204892 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110204892 (RAF1)
   05165 Human papillomavirus infection
    110204892 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110204892 (RAF1)
   01522 Endocrine resistance
    110204892 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110204892 (RAF1)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110204892 (RAF1)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110204892 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 Zf_RING
Other DBs
NCBI-GeneID: 110204892
NCBI-ProteinID: XP_020836742
UniProt: A0A6P5JR47
LinkDB
Position
Unknown
AA seq 667 aa
MEHFQGAWKTISNGFGFKDSVFDGSGCISPTLVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKTRLDWNTDAAS
LVGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSNVGDSGVPALPPLTMRRMRESVSQIPISSQHRYSTPHAFTF
STSPPSSEGSLSQRQRSTSTPNVHMVSTTMPVDSRIIENSSLNTSPRAWCRRSCLRARDA
IRSHSESASPSALSSSPNNLSPTGWSQSKTPVPTHRERAPASGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVIDPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINSCTLT
STRLPVF
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggagcattttcagggagcttggaagactatcagtaatggttttggatttaaagattca
gtctttgatggctctggctgtatttctcctactcttgtccagcagtttggctatcagcgc
cgggcatcagatgatggcaaacttacagattcctccaaaacaagtaacactatccgagtt
ttcttgccaaacaagcaaaggactgtggttaatgttcgaaatggaatgaccttgcatgat
tgccttatgaaggctcttaaagtgagaggcctgcagccagaatgttgtgcagtttttagg
cttctccatgaacacaaagggaaaaaaacacgtttagattggaatactgatgccgcctct
ttggtgggagaagaacttcaagtagatttcctggatcatgtccccctcacaacacacaat
tttgctcgaaaaactttcttaaagcttgccttctgtgatatttgtcagaagttcctgctg
aatggatttcgatgtcagacatgtggctacaagtttcacgagcactgtagcactaaggtc
cccactatgtgtgtggattggagtaatatcagacagctcttattgtttccaaattccaat
gttggtgatagtggtgtaccagcactacctcccctaacaatgcgtcggatgcgagaatct
gtttcccagatccccattagttcccagcacaggtattccacgccccacgcctttacgttc
agcacgtcgccaccgtcctcagagggctccctttctcagaggcagaggtctacatctacc
ccaaatgttcatatggtcagcaccaccatgccagtggacagtcggattatagagaatagc
agcctgaacacttctcccagggcgtggtgcagacggtcatgtttgagggcaagagatgca
attcgaagtcacagtgaatcagcctcaccttcagctctgtccagcagtccaaacaacctg
agtccaactggctggtctcagtccaagacccctgttccaacacacagagaaagagcccca
gcatccggtacacaagagaaaaataaaattaggccacgtggacagagagattcgagttat
tactgggaaatagaagccagtgaagtcatgctatcaaccagaatagggtcaggttcattt
gggacagtgtacaagggtaaatggcacggagacgttgctgtgaagatattaaaggtcatt
gatccaaccccagagcagtttcaggctttcaggaacgaagtggccgtcttaagaaaaacc
aggcatgttaacattctgttgttcatgggctatatgactaaagacaacctggcaattgtg
acacagtggtgtgaggggagcagtctttataagcacctccatgtccaggagaccaaattt
cagatgttccagcttatcgacattgcccggcagacagcacaaggaatggattatttacat
gcaaagaacatcatccacagagacatgaaatcaaataatatatttcttcatgaaggtctg
acagtgaaaataggagactttggtttggcaacagtaaaatctagatggagtggttctcag
caagtggaacagccaacaggttccgttctctggatggctccggaagttatccgcatgcag
gacaataatccattcagctttcaatcagatgtgtattcctatggcattgtgctgtatgaa
ctgatgacaggggaactaccatattcacacatcaacaaccgagatcagattatatttatg
gttggtcgagggtatgcatctccagatctcagcaagctatacaagaattgccccaaagcc
atgaagaggcttgtagcagactgtgtgaagaaagttaaggaagaaagacctctttttcca
cagatattgtcttccattgagttactacaacactctttaccgaaaatcaaccgcagtgct
tccgaaccctctctgcaccgtgcagcccacacagaggatataaactcatgcacgttgaca
tccacaagactcccggttttctag

KEGG   Phascolarctos cinereus (koala): 110216339
Entry
110216339         CDS       T05867                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04015  Rap1 signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04068  FoxO signaling pathway
pcw04150  mTOR signaling pathway
pcw04270  Vascular smooth muscle contraction
pcw04510  Focal adhesion
pcw04650  Natural killer cell mediated cytotoxicity
pcw04720  Long-term potentiation
pcw04722  Neurotrophin signaling pathway
pcw04726  Serotonergic synapse
pcw04730  Long-term depression
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04934  Cushing syndrome
pcw05010  Alzheimer disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05034  Alcoholism
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05216  Thyroid cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110216339 (BRAF)
   04012 ErbB signaling pathway
    110216339 (BRAF)
   04015 Rap1 signaling pathway
    110216339 (BRAF)
   04068 FoxO signaling pathway
    110216339 (BRAF)
   04024 cAMP signaling pathway
    110216339 (BRAF)
   04150 mTOR signaling pathway
    110216339 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110216339 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110216339 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110216339 (BRAF)
   04062 Chemokine signaling pathway
    110216339 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110216339 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    110216339 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    110216339 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110216339 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    110216339 (BRAF)
   04720 Long-term potentiation
    110216339 (BRAF)
   04730 Long-term depression
    110216339 (BRAF)
   04722 Neurotrophin signaling pathway
    110216339 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110216339 (BRAF)
   05205 Proteoglycans in cancer
    110216339 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110216339 (BRAF)
   05212 Pancreatic cancer
    110216339 (BRAF)
   05225 Hepatocellular carcinoma
    110216339 (BRAF)
   05226 Gastric cancer
    110216339 (BRAF)
   05214 Glioma
    110216339 (BRAF)
   05216 Thyroid cancer
    110216339 (BRAF)
   05221 Acute myeloid leukemia
    110216339 (BRAF)
   05220 Chronic myeloid leukemia
    110216339 (BRAF)
   05218 Melanoma
    110216339 (BRAF)
   05211 Renal cell carcinoma
    110216339 (BRAF)
   05219 Bladder cancer
    110216339 (BRAF)
   05215 Prostate cancer
    110216339 (BRAF)
   05213 Endometrial cancer
    110216339 (BRAF)
   05224 Breast cancer
    110216339 (BRAF)
   05223 Non-small cell lung cancer
    110216339 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110216339 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    110216339 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    110216339 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110216339 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110216339 (BRAF)
   05160 Hepatitis C
    110216339 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110216339 (BRAF)
   01522 Endocrine resistance
    110216339 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110216339 (BRAF)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110216339 (BRAF)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110216339 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 110216339
NCBI-ProteinID: XP_020853802
UniProt: A0A6P5L7D1
LinkDB
Position
Unknown
AA seq 803 aa
MAALSGGGGGGAEQGPALFNGDMDPEAGAGSASSAEPAIPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVSSSASTDTVTSSS
SSSLSVAPSSLAVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKA
LMMRGLIPECCAVYRRQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFT
LAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEE
ASLGESTLTSGSSPSAPPSDSIGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSS
SAPNVHINTIEPVNIDDLIRDQGLRGDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFD
FEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRR
DSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGV
LRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGM
DYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEV
IRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSN
CPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFS
LYACASPKTPIQAGGYGEFAAFK
NT seq 2412 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggcgcggagcagggccccgctctcttcaac
ggggacatggatcccgaggctggcgccggctcggcgtcctccgccgagccggccatcccc
gaggaggtgtggaacatcaagcaaatgattaaattgacacaggaacacatagaggcccta
ttggacaagttcggaggggaacataatccaccatcaatctacctggaggcctatgaagaa
tataccagcaagctagatgcacttcaacaacgggaacaacaattattagagtccatgggg
aatggaactgatttttctgtttctagctcagcttcaacagacacagttacatcttcttcc
tcttctagcctttcagtggcaccttcatctcttgcagtttttcagaatcctacagatgta
tcaagaagcaaccctaagtcaccacaaaaaccaattgttagagtcttcctgcccaacaaa
cagaggactgtggtgccagcaagatgtggggtgacagtccgagacagtctaaagaaagca
ttgatgatgagaggcctgatcccagaatgctgtgctgtgtacagaagacaggatggagag
aagaagcctattggctgggacactgatatttcctggcttactggagaagaattgcacgta
gaagttttggagaatgttcccctaacgacacacaattttgtacggaagacattttttacc
ttagcattctgtgacttttgtcgaaagttgcttttccaaggtttccgctgtcagacatgt
ggttacaaatttcaccaacgctgtagtacagaggtgccactgatgtgtgttaattatgac
cagcttgatttgctgtttgtctccaagttctttgaacaccacccaataccgcaggaggag
gcctccttaggagagagcacccttacgtcgggatcatccccttcagcacccccctcagat
tctattgggcccccaattcttaccagtccatcgccttcaaaatccattccaatcccacag
ccttttcgaccagcagatgaggatcatcggaaccagtttgggcaacgagaccggtcctca
tcggctcccaatgtgcatataaatacaatagaacctgtcaatattgatgacttgattaga
gaccaagggttacggggtgatggagcccccttgaaccaactgatgcgctgtcttcggaaa
taccaatcccggactcccagtcccctcctacattctgtccccagtgaaatagtgtttgat
tttgagcctggcccagtgttcagagggtcaaccacaggcttgtctgccacccctcctgct
tccttgcctggatctttaactaatgtgaaagcattacaaaaatctccaggacctcagcgt
gaaagaaaatcttcatcatcttctgaagacaggaatagaatgaaaacccttggtcgacgg
gactcaagtgatgattgggagattccagatgggcagattacagttggacaaaggatagga
tctggatcatttggaacagtctacaagggaaaatggcatggtgatgtagctgtgaaaatg
ttgaatgtgacagcacccacacctcagcagttacaggctttcaaaaatgaagtaggagtg
ctcaggaaaacgcgacatgtgaatatcctactctttatgggctattcaacaaaaccacag
ttggccattgttacacagtggtgtgaaggctccagtttatatcaccatctacatatcatt
gagaccaaatttgagatgatcaagctaatagatattgcacggcaaacagcacaaggcatg
gattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatatttctt
catgaagacctcacagtaaaaataggggattttggtctggctacagtaaaatctcggtgg
agtggctcccatcagtttgaacagttgtctggatctatcttgtggatggcaccagaggtc
attagaatgcaagataaaaacccatatagctttcaatcagatgtatatgcgtttgggatt
gttctgtatgagttgatgacgggacaattaccttactcaaacatcaacaacagggaccag
ataatttttatggtggggcgaggatacctgtctccagatctcagtaaggtgcggagtaat
tgtccaaaagccatgaagaggttaatggcagagtgcctgaagaagaagagagatgagagg
ccactttttccccagatccttgcctccattgaacttctggcccgctcattgccaaaaatt
caccgcagtgcatctgaaccctcactgaatcgggctggcttccaaacggaggattttagt
ctgtatgcttgtgcttctccaaaaacgcccatccaggcagggggatatggagaatttgcc
gccttcaagtag

DBGET integrated database retrieval system